KEGG   Verminephrobacter eiseniae: Veis_0861Help
Entry
Veis_0861         CDS       T00460                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00760  Nicotinate and nicotinamide metabolism
vei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Veis_0861
Enzymes [BR:vei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Veis_0861
    3.5.1.-  
     Veis_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase TAT_signal
Motif
Other DBs
NCBI-ProteinID: ABM56640
UniProt: A1WG83
Position
958186..958908
Genome map
AA seq 240 aa AA seqDB search
MPLAPRRRFLQSAAGTLAGAGFPPAAAAARIKPGANAVLIVVDVQNCFVPGGALPVARGD
EVVPVINRIATAFDNVVLTQDWHTPGHISFASSHAGKKPFDTIRLGYGEQRLWPDHCVQG
SQDAALHKDLHLPQAQMILRKGFHPQVDSYSAFEEADHKTATGLTGYLRQRGIESVFVAG
LATDFCVAWTALDARRLGFDTSVVEDACRAIDIDGSLQAAWKQMQAKGIERIQSGDIDIG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgccattggccccgcgtcgtcgttttcttcagtctgccgccggcacgctcgccggcgcc
ggcttccccccggcagcggcagcggccaggatcaagcccggcgcgaatgcggtgctgatc
gtggtcgatgtgcaaaactgctttgtccccggaggagcgctgcccgtggcccggggcgac
gaggtggtgccggtgatcaaccgcattgccacggccttcgacaacgtggtgctgacgcag
gactggcacaccccgggccacatatcctttgccagcagccatgcgggcaagaagccgttt
gacaccatccggctcggctacggcgagcaacggctgtggcccgaccactgcgtgcaaggc
agccaggacgccgcgctgcacaaagacctgcatctgccccaggcccagatgatcctgcgc
aagggctttcatccgcaggtggacagctactccgcgttcgaggaggccgaccacaaaacc
gccaccggcttgaccggatacctccgacagcgcggcatcgagagcgtgttcgtcgccggc
ctggcgaccgacttttgtgtggcctggacagcgctcgatgcccggcgcctgggtttcgat
acctctgtcgtggaagacgcctgccgcgccatcgacatcgatggctcgctgcaagcggcc
tggaaacagatgcaggccaagggcatcgagcgcatacagtccggcgacatcgacatcggc
tga

DBGET integrated database retrieval system