KEGG   Verminephrobacter eiseniae: Veis_1626Help
Entry
Veis_1626         CDS       T00460                                 

Definition
(GenBank) PHP C-terminal domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
vei  Verminephrobacter eiseniae
Brite
KEGG Orthology (KO) [BR:vei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Veis_1626
Enzymes [BR:vei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Veis_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ABM57384
UniProt: A1WIC7
Position
complement(1811950..1812861)
Genome map
AA seq 303 aa AA seqDB search
MPIPATIPLNADLHCHSVVSDGTLSPEDLAARARANGVQLWALTDHDETGGLRRAGAAAQ
AQGMAYLTGVEISVTFADTTVHIVGLGFDPDNAQLAQGLAATRDGRGERAKEMGAQLARA
GIGGAYEGALQFVGNPALISRMHFARFLVESGRCQDTGEVFRKYLTEGRPGYVPHRWARL
GDAVRWITEAEGVAVIAHPARYKFSANEEFALFSEFKAHGGQAVEVVTGSHSAAEYLSYA
ALAQEFGLAASRGSDFHSPAESHTDLGSLPPLPDALTPVWTLLADRIRHPARHLVPHWAP
DRA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatccctgccaccatccccctgaacgccgacctgcattgccattccgtggtctcc
gacggaaccctgagccctgaagacctggccgcccgggcccgtgccaacggggttcagttg
tgggccttgaccgatcatgacgaaaccggcggcctgcgccgcgctggcgctgccgcccag
gcgcagggcatggcctacctgaccggggtcgagatctcggtcacgttcgccgacaccacc
gtgcatatcgtgggcctgggcttcgaccccgacaatgcccagttggcgcagggcctggcg
gccacccgcgacgggcgcggcgaacgcgccaaggagatgggcgcgcaactggcccgggcg
ggcattgggggcgcttacgaaggcgcattgcagttcgtcggcaacccggcgctgatctcg
cgcatgcatttcgcgcgctttctggtcgaaagcggccgctgccaggataccggcgaggtg
tttcgcaaatacctcaccgagggccggcccggctatgtgccgcaccgctgggcccggctg
ggcgacgcggtgcgctggatcaccgaggcggagggcgtggccgtgatcgctcacccggcg
cgctacaagttcagtgccaacgaggaatttgcgctgttttccgaattcaaggcccatggc
ggccaggccgtggaggtcgtcaccggcagccacagcgccgccgaatacctgagctatgcc
gcgctggcgcaagagttcggcctggccgcttcgcgcggcagcgacttccacagccccgct
gaatcgcacaccgatctgggcagcctgccgccgctgcccgatgccttgacgccggtgtgg
acgctgctggccgaccgcatccgccatccggcccggcatttggtcccgcattgggccccc
gatcgggcctga

DBGET integrated database retrieval system