KEGG   Verminephrobacter eiseniae: Veis_1655Help
Entry
Veis_1655         CDS       T00460                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei01040  Biosynthesis of unsaturated fatty acids
vei01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Veis_1655
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Veis_1655
Lipid biosynthesis proteins [BR:vei01004]
 Desaturase
  First
   Veis_1655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ABM57412
UniProt: A1WIF5
Position
complement(1840037..1841251)
Genome map
AA seq 404 aa AA seqDB search
MLLPDWAVLNAAIDWLGHGSWRLAWWQIVLYTLATTHVTIAAVTIFLHRAQAHRALDLHA
IAAHGLRFWLWLGTGMVTREWVAIHRKHHAKCETAADPHSPQVRGLNAVLWRGAELYRAE
AGNLETLRKFGHGTPDDWIERNVYSRYSGLGIGLMLILDLALFGALGAAVWAVQMLWIPF
WAAGVVNGLGHYWGYRNFEVPDASTNLSPWGLIIGGEELHNNHHTYPTSAKFSVKPYEFD
MGWVYIRLLQKIGWATVRKLPPKLQLGDLRPMADEKTLEALIAHRYEVMASYARGVRQAC
KAEMAALQAHHGDLSMLKAARRWLHRDAQRVPARAVPQLALVRAAHPALDKMLTMREELR
QLWLNTSQSREQLTAGLQAWCRRAESSGIAALRDFSIGLRAVRV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgctgttacccgattgggctgtgttgaacgctgccattgactggctgggccatgggtcg
tggcgcctggcctggtggcagatcgtgctgtacaccttggcgacgacccatgtcaccatt
gctgcggtcacgatcttcctgcaccgcgcccaggcgcaccgggcgctcgatttgcatgcc
attgccgcgcatggcctgcgcttttggctctggctcggcaccggcatggtgacccgggaa
tgggtggccatccaccgcaagcaccacgccaagtgcgaaacggcggccgatccgcacagc
ccccaggtgcgcggcctgaacgccgtgctgtggcgcggcgccgagttgtaccgcgccgag
gccgggaacctggaaacgctgcgcaagttcggccatggcacgcccgatgactggatcgag
cgcaatgtctacagccgctacagcgggcttggcatcggcctgatgctgatcctggacctg
gccctgttcggcgctttgggcgccgccgtgtgggccgtgcaaatgctctggattcctttt
tgggccgcaggtgtggtcaacgggctgggccattactggggctatcgcaatttcgaggtg
cccgacgccagcaccaatctgtcgccctggggcctgatcatcggtggcgaagaattgcac
aacaaccaccacacctatccgacctcggccaagttctcggtcaagccgtatgagttcgac
atgggctgggtttacatccgcctgctgcaaaagatcggctgggccacggtcaggaaactg
ccgcccaagttgcaactcggtgacctgcggcccatggccgatgaaaagaccctggaggct
ttgatcgcccatcgctacgaggtgatggcaagctacgcccgtggtgtgcgccaggcctgc
aaggccgagatggcggcattgcaagcgcatcatggcgacctgtccatgctcaaggccgcc
aggcgctggctgcaccgcgatgcgcagcgggtgccggcccgggccgtgccccagttggcc
ttggtgcgcgcagcccaccccgcgctcgacaagatgctgaccatgcgcgaggaactgcgc
caactgtggctcaacacctcgcagtcgcgcgagcagttgacggcgggtctgcaagcctgg
tgcaggcgggccgagagcagcgggattgccgcgctgcgcgatttctcgatcggcttgcgt
gccgtgcgggtgtga

DBGET integrated database retrieval system