KEGG   Verminephrobacter eiseniae: Veis_2025Help
Entry
Veis_2025         CDS       T00460                                 

Definition
(GenBank) ABC transporter related
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Veis_2025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vei02000]
    Veis_2025
Enzymes [BR:vei01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Veis_2025
Transporters [BR:vei02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Veis_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_22 ABC_ATPase SMC_N AAA_29 RsgA_GTPase Zeta_toxin AAA_25 AAA_30 MMR_HSR1 AAA_23 Ploopntkinase3 TrwB_AAD_bind DUF87 AAA_15
Motif
Other DBs
NCBI-ProteinID: ABM57777
UniProt: A1WJH0
Position
complement(2302654..2304213)
Genome map
AA seq 519 aa AA seqDB search
MNAPRTPLLEMRGIDKAFGGVPALRQSRLCVGRGEVHALIGQNGAGKSTLIKILTGAYAR
DAGTIVFDGKGVDFKVPIAAQRAGLSTIYQELNLVPQRSVAENIFLGREPTRFGLIDWRH
VEVESARILAGFGMSVDVSRPLRSCNTATQQMTAIARAVSMRAKLVIMDEPTSSLDETEV
STLFGVIRKLKADGVSVVFVSHRLDELYAVCDRITVMRDGQTVAEREMAGFPKLDLVAAM
LGKELSVLQGTRRAGPDASMPEVLGVQHLRSGTRVKDASVTVRRGEIVGLGGLLGSGRTE
LARAVFGADAVDAGQIRIKGKLVKLDEPADAIARGVAFLSEDRKTEGIIADLSIRENLCL
VLSPRLARLGIVDNRKQHEITEEFIRKLGIRCAGPDQPIRELSGGNQQKVLLARWLAAGI
DLLLLDEPTRGIDVGAKAEILELIRGLADSQGLSVLIIASELEELVAASDRVAVLRDGHT
VAELTGDDINESAVMAAMANGTANAAAPAQAGIQEVAHG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccccggacgccgctgctggagatgcgcggcatcgataaggccttcggcggc
gtgccggctctgcgccagagccggctgtgcgtaggccgtggcgaggtgcatgccctgata
ggacagaacggcgccggcaagtccacgctgatcaagatcctgacaggtgcctacgcgcgc
gacgccgggaccatcgtgttcgatggcaagggggtcgatttcaaagttcccattgcggcg
cagcgcgctggattgagcacgatctaccaggagctcaatctggtgccgcaacgctcggtc
gccgaaaacatttttctcggtcgcgagcccacccgcttcggcctgatcgattggcgccat
gtggaagtcgagagtgcacgcatcctggcgggctttggcatgtcggtcgatgtcagccgg
ccgctgcggtcgtgcaacaccgccacccagcagatgacggccattgcccgcgccgtcagc
atgcgcgccaagctggtcatcatggacgagcccacctcgtcgctggacgaaaccgaggtg
agcaccttgtttggcgtgatccgaaaactcaaggccgatggcgtttcggtcgtgttcgtc
agccaccggctggatgagctctacgccgtgtgcgaccgcatcaccgtcatgcgtgatgga
cagacagtggccgagcgcgagatggcgggctttccaaagctggatctggtcgccgccatg
cttggcaaagagctgtcggtgttgcagggcacgcgccgagccggtcccgatgcatcgatg
cctgaggtgctgggcgtccagcacttgcgcagcggcacgcgtgtgaaggatgccagtgtc
accgtgcggcgcggcgagattgttggcttgggggggctactcggctcgggccgcaccgag
ctcgcgcgcgcggtgttcggcgccgatgcggtcgatgcggggcagatccgaatcaagggc
aagctggtcaagctggacgagccggccgacgccattgcccgcggcgtggccttcttgtcg
gaagaccgcaagaccgagggcatcatcgccgacctgtcgatccgcgaaaacctttgcctt
gttctgtcgccccgcctggcgcgactgggcatcgttgataaccgcaagcagcacgagatc
acggaagaattcatccgcaagctgggcatccgctgcgctgggccggaccagccgattcgg
gaattatctggcggcaatcagcaaaaggtgctgctggcgcgttggctggccgccggcatc
gatctgctgctgctggacgagcccacgcgaggcatcgacgtcggcgccaaggctgagatc
ctcgaactgattcgcgggctggccgattcgcaagggctgtcggtcttgatcattgccagc
gaactggaagaactcgtcgctgccagcgaccgcgtggcggtgctgcgcgatggccacaca
gtggccgagctgaccggcgacgacatcaacgaaagtgccgtgatggcagcgatggccaac
ggaacggctaacgcggctgcgccggcgcaggcgggaattcaggaggtggcacatggctga

DBGET integrated database retrieval system