KEGG   Verminephrobacter eiseniae: Veis_2815Help
Entry
Veis_2815         CDS       T00460                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00010  Glycolysis / Gluconeogenesis
vei00051  Fructose and mannose metabolism
vei00562  Inositol phosphate metabolism
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
vei01230  Biosynthesis of amino acids
Module
vei_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_2815
   00051 Fructose and mannose metabolism
    Veis_2815
   00562 Inositol phosphate metabolism
    Veis_2815
Enzymes [BR:vei01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Veis_2815
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Veis_2815
  Exosomal proteins of bladder cancer cells
   Veis_2815
  Exosomal proteins of melanoma cells
   Veis_2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM58553
UniProt: A1WLP6
Position
complement(3162984..3163796)
Genome map
AA seq 270 aa AA seqDB search
MAMTMNDRKKLIVGNWKMNGSLAANQDLLQAIRAGIADLDAAACTVALAVPAPYLAQVQA
LVAGSALALAAQDLSPHEAGAYTGEVSAAMLKDFGVRYALVGHSERRQYHGETDALVAKK
VQRALAAGLTPIVCLGETLPEREAGQTEAVVRRQLAAVIQLNGHCISEVVLAYEPVWAIG
TGRTASARQAQAVHAVLRAQLGAASSHAGRIRLLYGGSMNAANAAPLLAQPDIDGGLVGG
AALKAPDFLQIIAAACADGGPAMESGVNRQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggccatgaccatgaacgacaggaaaaaactcatcgtcggcaactggaagatgaatggc
agcctggccgcgaaccaggacttgctgcaggccatccgcgccggcatcgccgacctggat
gctgccgcttgcactgtggcgctggccgtgcccgcgccttatctggcgcaggtgcaggcg
ttggtggccggctcggcgctggcgctggccgcgcaggatctgtcaccgcacgaggccggc
gcctataccggcgaggtgtcggcagccatgctcaaggactttggcgtgcgctatgcgctg
gtcgggcattccgagcggcgccagtaccacggtgaaaccgacgcgctggtggccaagaag
gtgcagcgcgcgctggcggcgggtctgacgcccatcgtctgcctgggcgagaccttgcca
gagcgtgaggccggccagaccgaggccgtggtccggcgccaactggcggcagtgatacag
ctcaacggccattgcatcagtgaggtggtgctggcgtatgagccggtctgggccatagga
acgggccgcacggcgtctgcacggcaagcgcaggcggtgcatgccgtgctgcgcgcgcaa
cttggcgctgccagcagccatgccgggcgcatccgtctgctgtacggcggcagcatgaac
gcggccaacgccgcgccattgctggcgcagcccgacatcgacggcgggctggtcggcggc
gcagcgctgaaggcgccggactttttgcaaatcatcgcggcggcctgcgcagacggcggg
ccagcgatggaatcaggggtgaacagacaatga

DBGET integrated database retrieval system