KEGG   Verminephrobacter eiseniae: Veis_3696
Entry
Veis_3696         CDS       T00460                                 
Name
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
vei  Verminephrobacter eiseniae
Pathway
vei02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vei00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Veis_3696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vei02044]
    Veis_3696
Secretion system [BR:vei02044]
 Type IV secretion system
  Trb secretion system protein
   Veis_3696
SSDB
Motif
Pfam: CagX DUF6578
Other DBs
NCBI-ProteinID: ABM59411
UniProt: A1WP54
Position
complement(4087935..4088753)
AA seq 272 aa
MKLRTFAITASVLAGSALAQAAPESEISVPIPGNLDPRIVTFAYTPDVVYQLPVTVGMHT
HIPFTADEELSEPPSIGEKVRWRLEGNEKNIYIKALQPGVRTSLTLVTNKRTYQFELIAT
TKPNERIQKAQFTYPDEQAGIQMAWRNKTERAAEQAAQIERHRKAQNLSDAPMDASQLAF
YSVRTDNTQYQRMHVYSDGVKTWMRLPPGVQDLPAVFMVDKDQRGREQLMPVNYTVADRE
NLRDRDVIIIDRTAALWMLRIGQSIEVRVARD
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaaactgcgcaccttcgccatcactgcatctgttctggctggcagcgccctggcgcag
gccgcgcccgagagcgaaatctccgtgccgatccccggaaatctcgatccgcgcatcgtg
acgttcgcctatacgcccgatgtggtctatcaactgccggtgacggtgggcatgcacacc
cacattcctttcacggccgatgaagagctgtcggagccgccctcgatcggcgagaaggtg
cgctggcggctcgaaggcaatgagaagaacatctacatcaaggcgctgcagccgggggtg
cgcacctccctgacgctggtcaccaacaagcggacataccagttcgagctgatcgccacg
acaaagccgaacgagcgcatccagaaggcgcagttcacctaccccgatgagcaagccggc
atccagatggcctggcgcaacaagaccgagcgtgccgccgagcaagccgcgcagatcgag
cgccaccgcaaggcgcagaacctgtcggacgcccccatggacgccagccaactggcgttc
tattcggtgcgcacggacaacacgcagtaccagcgcatgcatgtctattccgatggcgtc
aagacctggatgcggctgcccccgggagtgcaggaccttccggcggttttcatggtggac
aaggaccagcgcggccgtgagcaactgatgccggtgaactacacggttgccgatcgcgaa
aacctgcgcgaccgggacgtgatcatcatcgaccgtacggcagcgctgtggatgctgcgc
atcggccagtccatcgaggtccgtgtggcacgcgattga

DBGET integrated database retrieval system