KEGG   Verminephrobacter eiseniae: Veis_3707
Entry
Veis_3707         CDS       T00460                                 
Name
(GenBank) hypothetical protein
Organism
vei  Verminephrobacter eiseniae
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: ABM59422
UniProt: A1WP65
Position
complement(4100151..4100906)
AA seq 251 aa
MAVCNLPMRSGCLHFFVTAAIATFACPMDADAGPSDGWLSVYSCANGKLVQSRVDGNDSS
NASRLLRAGHAVWTNGRLDENIIDAMAEGRGIWSAAPLTTLARITGAPIPAEILTAIALK
ETGLNGRFWPWSIHWSGRSYRLPSRQQAVAAAKYLLAQGITNFDVSVMQVNWRWHSGKFA
SIQAAFDPVANIQVAGQILNEHFLATGNWRSAIARYHSRTPALHQPYLADVLGHLRRIQT
STVEPPEKHLC
NT seq 756 nt   +upstreamnt  +downstreamnt
ttggcagtttgtaatctgccgatgcgctcaggttgtctccatttctttgtcacagcagcc
attgccacattcgcttgcccgatggatgcggatgcaggcccgtccgatggctggttgtcg
gtttattcctgcgccaacggcaaactggttcaatcccgtgtggacggcaatgattcatcg
aatgcaagccggctgctgcgcgcggggcacgctgtctggacgaatggacggctcgatgaa
aacatcatcgatgcgatggccgagggccggggaatctggtctgcagcgccgttgacgacg
ctggcgcgcatcacgggcgcgccaattcccgctgaaatcctgacggccatcgcgctcaag
gaaacgggcctgaatggccgcttctggccctggtcgatccattggagcggccgcagttac
cgccttccatcgcggcagcaagccgtggctgcggcgaaatatctgctggcacagggcatc
acgaacttcgatgtctcggtgatgcaggtgaactggcgctggcattccggaaagttcgca
agcatacaagccgcgttcgatccggtggccaacatccaggtggccggccagatcttgaac
gagcattttctggccaccggcaattggcgctcggccatcgcccgctaccacagccgcacc
ccggcgctccatcagccctatctggccgatgtgctggggcatttgaggcgcattcagaca
tccaccgttgaaccccccgaaaagcacctatgctga

DBGET integrated database retrieval system