KEGG   Verminephrobacter eiseniae: Veis_3782
Entry
Veis_3782         CDS       T00460                                 

Definition
(GenBank) tRNA-processing RNAse BN
  KO
K07058  membrane protein
Organism
vei  Verminephrobacter eiseniae
Brite
KEGG Orthology (KO) [BR:vei00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Veis_3782
SSDB
Motif
Pfam: Virul_fac_BrkB
Other DBs
NCBI-ProteinID: ABM59494
UniProt: A1WPD7
Position
complement(4173443..4174696)
AA seq 417 aa
MSLPFSLSVAARRIEALLGDLSRFPWKTTAQTLRERFRADHLGLTASSLTFTTILALVPF
FTVALAVFTAFPIFGQLQDALQGWLVSSLVPDSIARQVLGYLTQFAAKASGLGLAGFSVL
LVTALALILTIDRTLNDIWRVQRLRPLGQRVLIYWAAITLGPLLLGASLALTSYVMSASG
GLVKRLPDGVRFLFDSLQFMVLAAGMALLYHYVPNTPVRWRHAWSGGLFVALCIELAKKA
LALYLGRVPTYSVVYGAFATLPILLVWIYMAWVIVLLGAVVTAYLPSLLAGVARRGTVAG
WTFQLALEVLQQLHRVRHDAGKGLRAGQLAQLLRVDVLQLEPVLESLTALDWVGQVSAVV
VAASDPPEPRYVLLADPQSTLLEPLVHKLLLERSESLGPLWDKAGLGRLQMADVLAR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtccttgcctttttcgttgtcggtggcggcccggcgcatcgaggcgctgctcggcgat
ctgtcgcgctttccctggaaaaccaccgcccagaccctgcgcgagcgctttcgcgcggac
catctggggctgacggccagcagtctgacctttaccaccatcctggcgctggtgccgttt
ttcacggtggcgttggcggtgttcactgcgtttccgatctttggccagttgcaggatgcg
ctgcagggctggctggtcagcagtctggtgcccgacagcatcgcgcgccaggtgctgggc
tatctgacgcagtttgcggccaaggccagcggcctgggcctggcgggtttcagcgttttg
ctggtcacggccctggcgctgatcctgaccatcgaccgcacgctcaacgacatctggcgt
gtgcagcgcctgcggccgctggggcagcgggtgctgatctactgggccgcgatcacgctg
ggcccgttgctgttgggcgcgagcctggcgctgacctcgtatgtgatgtcggcctccggc
gggctggtcaagcgcctgccggacggggtgcggttcctgttcgattcgctgcagttcatg
gtgctggccgccggcatggcgctgctctaccactatgtgcccaacaccccggtgcgctgg
cggcatgcgtggagcgggggcttgttcgtcgcgctgtgcatcgaactggccaagaaggcg
ctggcgctgtacctgggccgggtgcccacttattcggtggtctacggggcctttgccacc
ttgccgatcctgctggtgtggatctatatggcctgggtgatcgtgctgctcggggcggtg
gtcacggcctatctgcccagtcttttggccggggtggcgcggcgtggcacggtggcgggc
tggacgttccagttggcgctggaggtgttgcagcagttgcaccgcgtgcgccacgatgcg
ggcaagggcttgcgtgccggccagttggcgcagttgctgcgggtggatgtgctgcaactc
gagccggtgctggagtcgttgacggcgctcgattgggtggggcaggtgagtgcggtcgtg
gtggctgcgtcggacccgccggagccccgctatgtgctgctggcggacccgcagagcacc
ctgctggagccgctggtgcacaagctgctgctggagcgctccgagagcctggggccgctg
tgggacaaggccgggcttgggcgcttgcagatggcggatgtgctggcgcggtga

DBGET integrated database retrieval system