KEGG   Verminephrobacter eiseniae: Veis_4193Help
Entry
Veis_4193         CDS       T00460                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00071  Fatty acid degradation
vei00072  Synthesis and degradation of ketone bodies
vei00280  Valine, leucine and isoleucine degradation
vei00310  Lysine degradation
vei00362  Benzoate degradation
vei00380  Tryptophan metabolism
vei00620  Pyruvate metabolism
vei00630  Glyoxylate and dicarboxylate metabolism
vei00640  Propanoate metabolism
vei00650  Butanoate metabolism
vei00900  Terpenoid backbone biosynthesis
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
vei01130  Biosynthesis of antibiotics
vei01200  Carbon metabolism
vei01212  Fatty acid metabolism
vei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Veis_4193
   00630 Glyoxylate and dicarboxylate metabolism
    Veis_4193
   00640 Propanoate metabolism
    Veis_4193
   00650 Butanoate metabolism
    Veis_4193
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Veis_4193
   00072 Synthesis and degradation of ketone bodies
    Veis_4193
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Veis_4193
   00310 Lysine degradation
    Veis_4193
   00380 Tryptophan metabolism
    Veis_4193
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Veis_4193
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Veis_4193
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Veis_4193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vei04147]
    Veis_4193
Enzymes [BR:vei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Veis_4193
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Veis_4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM59898
UniProt: A1WQJ1
Position
4617990..4619171
Genome map
AA seq 393 aa AA seqDB search
MTIDAVIVSTARTPIGKAYRGAFNDTHGAVLGAHAVRHAVERAGLAPDEIEDVIMGTARP
EGSTGMNIGRIVALRAGLPKHTAGVTVNRFCSSGLQAIAMGAHSILCDGVPAVVAGGLDA
VSLTVNTDTNTYRQRDSWLEQHVPGLYQTMIQTAESVATRYGIGREQQDAYGLRSQQRAV
AARDADAFAQEISPIEVRKLVAGKDGAPDTHEDITLTHDEGLRSTSTQQLAALKPVIEGG
HITAGNASQLSDGTSACVLMNSRLAEQRNLTPLGIFRGFAVAGCEPDEMGIGPVFAVPRL
LARCGVRADDVGLWELNEAFAVQVLYCRDRLGIPDERLNIHGGAIAMGHPFGMSGSRLVG
HALIAGKALGVRHVVVTMCVGGGMGAAGLFEVV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgatgccgtcatcgtttccaccgcacgaacgcccatcggcaaggcctaccgc
ggcgccttcaacgacacgcatggtgccgtgctcggcgcgcacgccgtgcgccatgccgtc
gaacgcgccgggctggcccccgacgagatcgaggacgtgatcatgggaacggcccgcccc
gagggcagcacgggcatgaacatcggccgcatcgtcgcgctgcgcgccgggctgccgaaa
cacacggcgggcgtgacggtgaaccgcttctgcagctcgggcctgcaggccattgcgatg
ggcgcgcacagcattctgtgcgacggtgtgcccgcggtggtggcaggcgggctcgacgcc
gtgagcctcacggtcaacacggacaccaacacctaccgccagcgcgactcgtggctggag
cagcatgtgccgggcctgtaccagaccatgatccagaccgccgagagcgtggccacgcgc
tacggcatcggtcgcgagcagcaagacgcttacggcctgcgcagccagcagcgggcggtg
gccgcgcgcgacgccgacgccttcgcgcaagagatctcgcccatcgaggtgcgcaagctc
gtggccggcaaggacggcgcacccgacacgcacgaggacatcacgctgacgcacgacgaa
ggtctacgcagcacgtcgacgcagcagttggcggccctcaagccggtgatcgaaggcggc
catatcacggcaggcaatgcgagccaactttccgatggcacctccgcctgcgtgctgatg
aacagccggctggccgagcagcgcaacctcacgccgctgggcatcttccgcggctttgcc
gtggccggctgcgagcccgacgagatgggcatcggcccggtgtttgcggtgccgcgcctg
ctcgcgcgctgcggcgtgcgcgccgacgacgtcggtctgtgggaactcaacgaagccttc
gccgtgcaggtgctctactgtcgcgaccggctgggcattccggacgagcgcctgaacatc
cacggcggcgcgatcgcaatgggccacccgttcggcatgtcgggctcgcggctcgtgggc
cacgcgctgatcgccggcaaggcgctcggcgtgcgccatgtggtcgtcacgatgtgcgtg
ggcggcgggatgggcgcagcggggttgttcgaagttgtttga

DBGET integrated database retrieval system