KEGG   Verminephrobacter eiseniae: Veis_4412
Entry
Veis_4412         CDS       T00460                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vei  Verminephrobacter eiseniae
SSDB
Other DBs
NCBI-ProteinID: ABM60115
UniProt: A1WR58
Position
complement(4863280..4863468)
AA seq 62 aa
MNQQYPSKEQFFERLGALTDAMIAAYGKDFAMGAMILAVRFVAEGKPLGDHFPGVIPEKV
GA
NT seq 189 nt   +upstreamnt  +downstreamnt
atgaaccagcaatacccgtccaaagagcagttcttcgagcgcttgggcgcgctgacagat
gcgatgatcgcggcctatggcaaggacttcgccatgggtgcgatgattctcgccgtgcgc
tttgtcgccgagggcaagccgttgggcgatcactttcccggtgtgatccctgaaaaggtc
ggcgcctga

DBGET integrated database retrieval system