KEGG   Verminephrobacter eiseniae: Veis_4480Help
Entry
Veis_4480         CDS       T00460                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00450  Selenocompound metabolism
vei00970  Aminoacyl-tRNA biosynthesis
vei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Veis_4480
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Veis_4480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vei01007]
    Veis_4480
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vei03016]
    Veis_4480
Enzymes [BR:vei01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Veis_4480
Amino acid related enzymes [BR:vei01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Veis_4480
Transfer RNA biogenesis [BR:vei03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Veis_4480
 Prokaryotic type
   Other AARSs
    Veis_4480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABM60181
UniProt: A1WRC4
Position
4951437..4953512
Genome map
AA seq 691 aa AA seqDB search
MPSTRKLFVTTALPYANGPFHLGHLMEYIQADIWVRFQRMQGHEVNFVGADDTHGAPIMI
AAEKAGKTPQQFVADIAAGRKPYLDGFHLSFDNWHSTDAPENHELARQIYRDLRDRADGS
LIERRSIEQFFDPGKSMFLPDRYIVGECPRCHAKEQYGDNCEQCGSVYAPAELIDPVSAL
SGAKPELRSSEHFFFKLSDPRCVEFLQRWTQDGKLQPEVANKVREWFGLRSNPDGSCSEG
LDDWDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLAALKNLLEKRGQNYDAYMADPALE
QYHFIGKDIVTFHTLFWPAMLHLSGRKTPDNVFVHGFLTINGEKMSKSRGTGLDPLKYLS
LGMNAEWLRYYLATKLSARNEDMDLGTEDFMVRVNSDLIGKYVNIASRAAGFLTKRFAGR
LTSDFGAAGLALLADLHGARDTIAQWYQAREFGKATREIMLLADKVNAYVDRNKPWELAK
DAANGQALHQVCSVLINAFATLTRYLSPVLPALARAAQDFVGQDMQRWDAGGAVQAIAPY
QHLMQRVTPEQLAALFQPPAAAQIAAAGAQEPGGLALAPGIGIDDFDRVDLRVALIVDCA
AVAGSTKLLRLTLDIGEGRQRQVFSGIASACQPADLIGKHTVMVANLAPRRLKFGVSEGM
VLAASHGDEKANPGIYLLAPGPGAKPGMRVR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgacacgcaagctcttcgtcaccaccgccctgccctacgcgaatggcccgttc
cacctcggccacctgatggagtacatacaggccgacatctgggtgcggtttcagaggatg
cagggccacgaagtgaacttcgtcggcgcagacgacacccatggcgcgccgatcatgatt
gccgccgaaaaagccggcaagacgccacagcagttcgtggccgacattgcggcaggccgc
aagccgtacctggacggctttcacctgagctttgacaactggcacagcaccgatgcgccg
gagaaccacgaactggcgcgccagatctaccgcgacctgcgcgaccgcgccgatggttcg
ctgatcgagcggcgcagcatcgagcagttcttcgaccccggcaagagcatgttcctgccc
gaccgctacatcgtcggcgaatgcccgcgctgccacgccaaggagcagtatggcgacaac
tgcgagcagtgcggctcggtgtatgcgcccgccgaactgatcgacccggtctcggccctg
tccggcgccaagcccgagctcaggagttccgagcatttcttcttcaagctctccgacccg
cgctgcgtggagtttctgcagcgctggacgcaagacggcaaactgcaacccgaggtggcc
aacaaggtccgggaatggtttggcctgcgcagcaaccccgacggcagctgcagcgagggc
ctcgatgactgggacatcagccgcgatgcgccctacttcggcatcgaaattcccgatgcg
ccgggcaaatacttctatgtctggctcgacgcgccggtgggttatctggcggcgctgaag
aacctgctggaaaagcgcggccaaaactacgacgcctacatggccgacccggcgctggag
cagtaccacttcatcggcaaggacatcgtcaccttccacaccctgttctggcccgcgatg
ctgcacctgagcgggcgcaagacgccggacaacgtgttcgtgcacggctttttgaccatc
aacggcgagaagatgagcaagagccgtggcacgggcctggacccgctcaaatacctgagc
ctgggcatgaacgccgagtggctgcgctactacctggcgaccaagctgagcgcgcgcaac
gaggacatggacctcggcaccgaggacttcatggtgcgcgtgaacagcgacctgatcggc
aaatacgtgaacattgccagccgcgctgcgggctttttgaccaagcgcttcgccggccgg
ctgaccagcgacttcggcgccgccggcctggccctgctggccgatctgcatggcgcccgc
gacaccatcgcgcagtggtaccaggcgcgcgagttcggcaaggcgacgcgcgagatcatg
ctgctggccgacaaggtcaacgcctatgtcgaccggaacaagccctgggaattggccaag
gatgcagcgaacgggcaggcgctgcaccaagtctgctcggtgctgatcaacgccttcgcc
acgctcacacgctacctgtcgcccgtgctgcccgccctggcccgcgccgcgcaggacttt
gtcggccaggacatgcagcggtgggatgcgggcggcgctgtgcaggccatcgcgccctac
cagcacctgatgcagcgcgtgacgcccgagcaactggccgccctgttccagcccccggcc
gctgcgcagatcgccgctgccggcgcgcaagaacccggcggcctggccctggcccccggc
atcggcatcgacgacttcgaccgcgtcgacctgcgcgttgcgctgatcgtcgactgcgcg
gccgtggcaggctcgaccaagctgctgcgcctgacactggacatcggcgaaggccgccag
cgccaggtgttcagcggcatcgccagcgcctgccagccggcagatctgatcggcaaacac
accgtgatggtggccaacctggcgccccgccgactgaagtttggcgtgagcgaaggcatg
gtgctggccgccagccatggcgacgagaaagccaaccccggcatctacctgctcgcgccc
gggcccggcgccaagcccggcatgcgggtgcggtag

DBGET integrated database retrieval system