KEGG   Verminephrobacter eiseniae: Veis_4949Help
Entry
Veis_4949         CDS       T00460                                 

Definition
(GenBank) lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00620  Pyruvate metabolism
vei00630  Glyoxylate and dicarboxylate metabolism
vei01100  Metabolic pathways
vei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Veis_4949
   00630 Glyoxylate and dicarboxylate metabolism
    Veis_4949
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Veis_4949
    1.2.1.22  lactaldehyde dehydrogenase
     Veis_4949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABM60636
UniProt: A1WSM9
Position
5472280..5473716
Genome map
AA seq 478 aa AA seqDB search
MPDTYQNYIDGRFVPHRGATIAVHNPADHRLIAEVPDGDAAAVDAAVSAARRAQPAWERL
PAIQRAGYLRQISVKLREHAEALATTIAREQGKVMPLARVEVNFTADYIDYMAEWARRLE
GEVLTSDRPNEHMFLLRKPIGVAAGILPWNFPFFLIARKMAPALITGNTVVIKPSEETPL
NAFAFTQLLAQTDLPPGVFNLVSGKGASTGAELVAHKGVNLITFTGSVTTGVRIMQAAAP
NLTRVNLELGGKAPAIVLKDADLDLAAQALVASRIINTGQVCNCAERVYVQREVLGALTD
KIVQRMAATRFGNPLLDETLDMGPLINQAGLDKVARLVDEARAAGAEVLTGGRRADVGHG
YHYLPTVVAGCRQDMSIMRDEIFGPVLPLQAVDDMDEAIALANDSDYGLTSSIFTRDLNA
AMKACRELQFGETYINREHFEAMQGFHAGRKKSGIGGADGRHGLLEFTETHVVYMQTT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacacctaccagaactacatcgacggccgtttcgtgccgcaccgcggcgccacc
atcgccgtccacaacccggccgaccaccgcctgatcgccgaggtgcccgacggcgatgcc
gctgctgtggacgcagccgtttctgccgcgcgccgcgcccagccagcttgggagaggctg
cccgcgatccagcgagccggctacctgcggcagatctcagtcaagctgcgcgagcacgcc
gaagcgctggccaccaccatcgcccgcgagcagggcaaggtcatgccgctggcgcgcgtc
gaggtgaacttcaccgccgactacatcgactacatggccgagtgggcgcgccgcctcgaa
ggcgaggtgctgacgagcgaccgccccaatgaacacatgttcctgctgcgcaagccgatc
ggcgtggcggcgggcatcctgccgtggaacttcccgttcttcctaatcgcccgcaagatg
gcgccggcgctgatcaccggcaacaccgtggtgatcaagccgagcgaggagacgccgctc
aacgccttcgcattcacccaactgctggcgcagaccgatctgccgccaggcgtgttcaac
ctggtgtcgggcaagggcgccagcaccggggccgagctagtggcgcacaagggcgtcaac
ctcatcaccttcaccggcagtgtgaccacgggcgtgcgcatcatgcaggcggcggcaccc
aacctcacgcgcgtgaaccttgaactgggcggcaaggcaccggccatcgtgctcaaggat
gccgacctggaccttgcggcccaggcgctggtggcctcgcgcatcatcaacactggccag
gtctgcaactgcgccgaacgcgtctacgtgcagcgcgaggtgctgggcgcgctgaccgac
aagatcgtgcagcgcatggccgccacgcgctttggcaacccgctgctcgacgagacgctg
gacatgggcccgctgatcaaccaggccgggctcgacaaggtggcccggctggtcgacgag
gcgcgcgccgcgggcgccgaagtgctgaccggcggccgccgcgccgacgtgggccacggc
taccactatcttcccaccgtcgtagccggctgccggcaggacatgtcgatcatgcgcgac
gagatcttcggtccggtgctgccgctgcaggcggtcgacgacatggacgaagccatcgca
ttggccaacgactctgactacggcctcacctcgtccatcttcacgcgcgacctgaacgcg
gcgatgaaggcgtgccgcgaactgcagttcggcgaaacctacatcaaccgcgagcacttc
gaggcgatgcagggcttccacgccggccgcaagaagtcgggcatcggcggagccgacggc
cgccatgggctgctggagttcaccgaaacgcatgttgtctacatgcagaccacctga

DBGET integrated database retrieval system