KEGG   Vibrio sp. EJY3: VEJY3_00955Help
Entry
VEJY3_00955       CDS       T01683                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00540  Lipopolysaccharide biosynthesis
vej01100  Metabolic pathways
Module
vej_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    VEJY3_00955 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vej01005]
    VEJY3_00955 (rfaD)
Enzymes [BR:vej01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     VEJY3_00955 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:vej01005]
 Unusual sugar
  VEJY3_00955 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind ThiF adh_short NAD_binding_4 KR 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEX20690
Position
1:complement(216713..217654)
Genome map
AA seq 313 aa AA seqDB search
MIIVTGGAGMIGSNIVKALNAAGMNDILVVDNLKNGKKFKNLVDLDITDYMDRDDFLTQI
MAGDDFGPIEAIFHEGACSATTEWDGKYMMLNNYEYSKELLHYCLDREIPFLYASSAATY
GETDTFVEEREYEGALNVYGYSKQQFDNYVRRLWQDAEEHGETLSQITGFRYFNVYGPRE
DHKGSMASVAFHLNNQLNAGENPKLFAGSETFKRDFVYVGDVCKVNLWFFENGVSGIFNC
GTGRAESFEEVAKAVITHHGKGEIETIPFPEHLKGAYQEFTQADLTKLRSAGCDVEFKTV
AEGVAEYLAIQNR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtaactggtggtgctggcatgattggcagcaacattgttaaagctctcaac
gcagctggtatgaacgatattctggttgtcgacaacctaaaaaatggtaaaaagtttaag
aacttagttgatctggacatcacagattacatggatcgtgacgacttccttacccaaatt
atggccggtgatgatttcggtcctatcgaagcaattttccatgaaggtgcttgttctgca
accaccgagtgggatggtaaatacatgatgctaaacaactatgagtactcaaaagagtta
ttgcattattgtttagaccgtgaaattccattcctttacgcctcttctgctgccacatac
ggtgagacagacacctttgttgaagagcgagaatacgaaggcgcactcaacgtctacggt
tattctaagcaacagtttgataactacgtacgtcgcttatggcaagacgctgaagagcac
ggtgagaccctatctcaaatcactggcttccgttacttcaatgtttacggccctcgtgaa
gaccataaaggaagcatggcatccgttgccttccacctaaataaccagctaaatgcaggt
gaaaacccgaaactcttcgctggtagtgagacctttaagcgtgatttcgtctacgtcggc
gatgtatgtaaagtcaacctgtggttctttgaaaacggagtatcaggcatctttaactgt
ggcacaggacgcgcggagtcgtttgaagaggtcgcgaaagcggtgatcactcaccacgga
aaaggtgaaatcgaaacgattcctttccctgagcatctaaaaggcgcttaccaggagttc
actcaagctgatctgactaagctacgctcagcaggctgcgacgtagaattcaaaacggtt
gcagaaggtgtcgctgaatacctagctatccaaaaccgctaa

DBGET integrated database retrieval system