KEGG   Vibrio sp. EJY3: VEJY3_02670Help
Entry
VEJY3_02670       CDS       T01683                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00630  Glyoxylate and dicarboxylate metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01200  Carbon metabolism
Module
vej_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_02670
Enzymes [BR:vej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VEJY3_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEX21032
UniProt: H2IF30
Position
1:605439..606749
Genome map
AA seq 436 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVELRGSMVPANTIAQRGADKLWSLVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSVP
SVVKRINNSFRRADQIQWAGGKSPEDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGTTTLVIARTDANAA
DLLTSDCDPYDKDFIEGERTQEGFYRVRAGIDQAISRGLAYAPYADLIWCETATPCLEEA
RKFAEAIHAEYPEQLLAYNCSPSFNWEKNLDAETIAKFQQELADMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEKVQRPEFQAAEKGYTFVAHQQEVGTGYFDRMTNTIQGG
NSSVTALTGSTEEDQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacattaactcgccgccaacaaattgaagctctagaaaaagactgggcaacgaatcca
cgctggaaaaacgtgaaacgtacttacactgctgaagaagttgttgaacttcgtggctct
atggttcctgcaaacacaattgcacagcgtggtgcagacaaattgtggtcactggtcaac
ggtagcgcgaaaaagggctacgttaactgtctgggcgcgctaactggcggccaagcggtt
caacaagcaaaagcaggtatcgaagcgatttacctttctggttggcaggttgctgcagat
aacaacactgcatcaacaatgtacccagaccaatcgctatacccagtagattcagtacct
tctgttgttaagcgtatcaacaactctttccgtcgtgctgaccaaattcagtgggctggc
ggcaagtctccagaagacgaaggtggtatcgattacttcctacctatcgtagcggatgct
gaagcgggctttggtggtgtactaaatgcttacgaactgatgaaatctatgattgaagca
ggtgcggcgggcgttcacttcgaagaccaacttgcttcagtgaagaagtgtggtcacatg
ggcggtaaagttctggttccgactcaagaagcggtacaaaaactggttgcggctcgtctg
gctgcagacgtagcaggtacaacaacactcgttatcgctcgtactgatgcgaacgcagca
gacctactaacgtcagattgcgacccatacgataaagactttatcgaaggtgagcgtact
caagaaggtttctaccgtgtacgtgctggcattgaccaagcaatctctcgtggtcttgct
tacgcaccatacgcagatttgatctggtgtgaaacagcaacgccttgtctggaagaagcg
cgtaagtttgcagaagcgattcacgcagagtacccagaacagctgctagcttacaactgt
tctccatcgttcaactgggagaaaaacctggatgcagagacaattgctaaattccagcaa
gagcttgcagacatgggctacaagtaccagttcattactctagcgggaattcacaacatg
tggttcaacatgtttgaactggcacatgcttatgctcaaggtgaaggtatgcgtcactac
gttgagaaagtacagcgcccagagttccaggctgcagaaaaaggttacacattcgtagct
caccagcaagaagttggtacaggttacttcgacagaatgaccaatacgatccaaggtggt
aactcatcagttacggcactaacgggttcgactgaagaagaccaattttaa

DBGET integrated database retrieval system