KEGG   Vibrio sp. EJY3: VEJY3_03865Help
Entry
VEJY3_03865       CDS       T01683                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00020  Citrate cycle (TCA cycle)
vej00640  Propanoate metabolism
vej00660  C5-Branched dibasic acid metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01130  Biosynthesis of antibiotics
vej01200  Carbon metabolism
Module
vej_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vej_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEJY3_03865 (sucC)
   00640 Propanoate metabolism
    VEJY3_03865 (sucC)
   00660 C5-Branched dibasic acid metabolism
    VEJY3_03865 (sucC)
Enzymes [BR:vej01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VEJY3_03865 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEX21271
UniProt: H2IGP1
Position
1:871359..872525
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKDGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRASRK
IVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLEGDQIKQFVKI
FMGLGTMFAQYDLALLEINPLVVTGEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVNVPVVVRLEGTNADLGREV
LANSDVDIIAAESLTDAAQKVVAAAEAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttacctgtgcca
gaaggctacgcgtgtgatacaccacaagaagcttttgaagcagcaggccgtattagtaca
gctaagaaagtcgttaagtgtcaggttcacgctggtggccgcggtaaagcgggcggcgta
gagctacacgatacaaaagatggcgtaaaagagtttgcgcaaaagtggctaggtaagaac
ctagtaacttaccaaacagatgcaaatggtcagcctgtaacaaaaatccttgttgaagaa
gcatcaaacattgcaaacgaactttacctaggtgcggtagttgaccgtgctagccgtaag
atcgttttcatggcttctactgaaggcggtgtggaaatcgaaaaagttgcggaagaaact
ccggagctaatccacaaagcagcaatcgatccactagtcggcccacaagcttaccaaggt
cgtgagcttgcgttcaaacttggtcttgaaggtgaccaaatcaaacaattcgttaagatc
ttcatgggtcttggcacgatgttcgctcagtacgaccttgctctactagagatcaaccca
cttgttgttactggcgaaggcaacctgctatgtcttgacggcaaaatcaacatcgactca
aacgctctataccgtcagcctaaacttcgtgaaatgcacgatccatcacaagaagatgag
cgtgaagcgcacgcagctcagtgggaactgaactacgtagcactagacggtaacgttggc
tgtatggttaacggtgctggccttgcaatgggtacgatggatatcgtaaacctacacggc
ggcaaacctgctaacttcctagacgtaggtggcggtgcaactaaagaacgtgttgcagaa
gcattcaagatcatcctatctgatgacaacgtgaaagcagtactagtaaacatcttcggt
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggtgcggttaaagaggtaggt
gtaaacgtaccagttgttgttcgtctagaaggtactaacgcagacctaggtcgcgaagtt
cttgctaattctgatgttgatatcattgctgctgagtcgctaacagatgctgctcagaaa
gttgttgctgctgcggaggctaaataa

DBGET integrated database retrieval system