KEGG   Vibrio sp. EJY3: VEJY3_10275Help
Entry
VEJY3_10275       CDS       T01683                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00260  Glycine, serine and threonine metabolism
vej00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01130  Biosynthesis of antibiotics
vej01230  Biosynthesis of amino acids
Module
vej_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VEJY3_10275
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VEJY3_10275
Enzymes [BR:vej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VEJY3_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1 DUF1967
Motif
Other DBs
NCBI-ProteinID: AEX22535
UniProt: H2IGV5
Position
1:2276225..2277415
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPEFRSEFMTLLQEYAGRPTALTH
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
EDAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGVEPAGKGIDTDQHGAPLKHGKTGIYFGMKAPIMQDENGQIEESYSVS
AGLDFPSVGPQHAYLNSIGRAEYANVTDDEALDAFQEIARSEGIIAALESSHALAHALRM
ARENPEKEQLLVVNLSGRGDKDIFTVNAILEEKGVI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgaatgcctactttggcgaatatggcggtcagtacgttccgcaaatcctc
gttcctgcattggagcaacttgagcaagcgtttattgacgcacaggaagatccagagttc
cgtagcgaattcatgacacttcttcaggaatatgcaggtcgccctacggcgctaacgcat
acccgcaacttaactaaaggtacaaagaccaaactgtacctaaagcgtgaagacttactc
cacggcggcgcacacaaaactaaccaggtgctaggtcaggctctactggctaagcgcatg
ggcaaaacagaaatcatcgctgaaaccggtgcgggtcaacacggtgtcgcaacagcacta
gcatgtgcgctacttggtctaaaatgtcgcgtttatatgggtgcgaaagacgttgagcgt
caaagcccgaacgtgttccgcatgaaactcatgggcgctgaagtcattccggtacattct
ggttcggcaacacttaaagatgcgtgtaatgaagcactgcgtgactggtcagcaacgtac
gaagacgcgcactacctactaggtacggcagcgggccctcacccgttcccaactatcgtt
cgcgagttccagcgtatgattggtgaagaaaccaagaaccagattctggctcgtgaagga
cgtcttccagatgcagttatcgcttgtgtaggcggtggctctaacgccattggtatgttt
gctgatttcatcgaagaagaaagtgttcgccttattggagtcgaacctgcaggtaaaggt
atcgataccgaccaacacggtgcgccgctgaaacacggtaagacaggcatttatttcggt
atgaaagcgccaatcatgcaagatgaaaacggacagatcgaagagtcctactccgtttct
gctggtctagattttccatctgttgggcctcagcacgcttacttgaattccattggccgt
gcggaatacgccaatgtaaccgatgatgaagccttggatgctttccaggaaattgcgcgt
agtgaaggtatcattgcggcacttgaatcgtctcacgcacttgcacacgcgttgcgtatg
gctcgcgaaaatccagaaaaagagcagcttttagtcgtcaacttatccggtcgtggtgac
aaagacatcttcaccgtaaacgccatcctagaagaaaaaggagtgatctaa

DBGET integrated database retrieval system