KEGG   Vibrio sp. EJY3: VEJY3_10760Help
Entry
VEJY3_10760       CDS       T01683                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00450  Selenocompound metabolism
vej00970  Aminoacyl-tRNA biosynthesis
vej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VEJY3_10760 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VEJY3_10760 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vej01007]
    VEJY3_10760 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vej03016]
    VEJY3_10760 (metG)
Enzymes [BR:vej01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VEJY3_10760 (metG)
Amino acid related enzymes [BR:vej01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VEJY3_10760 (metG)
Transfer RNA biogenesis [BR:vej03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VEJY3_10760 (metG)
 Prokaryotic type
   Other AARSs
    VEJY3_10760 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f FeoC PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AEX22632
Position
1:2392586..2394661
Genome map
AA seq 691 aa AA seqDB search
MANDPRPLSSRKMLVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNTVNFICADDAH
GTPIMLKAQQMGITPEEMIAAVSEEHQKDFAGFDISFDNYHSTHSEENRELASHIYLELK
KNGFISSRTISQLFDPEKEMFLPDRFVKGTCPKCKSEDQYGDNCDNCGETYSPTELINPK
SAVSGATPVMKDSEHFFFDLPQFESMLKEWTRSGSLQSETANKMQEWFESGLQQWDISRD
APYFGFEIPGEKNKFFYVWLDAPIGYMGSFKNLCDKRDDLDFDEYWNKDSSAELYHFIGK
DIVYFHSLFWPAMLDGSGFRKPNNVFVHGYVTVNGAKMSKSKGTFVKASTYLEHLDPECL
RYYYAAKLNSRIDDLDLNLEDFTQRVNADVVNKIVNLASRNAGFIAKRFEGKLSDNFAEP
ELYNEFVAAADRIAELYETREFGRAIREITALADKANQYVDEKAPWVVAKEEGKDQELQE
ICSVGINLFRVLMTYLKPVMPALAARTEAFLNQELTWENIAAPLTGHEITKFKALFNRID
PKNIEAMIEASKEDAAAEMAAKEKAEAEKNKASQTELDKDPIAEEIEFDAFAAVDMRIAR
IISCEEVPKANKLLKFQLDIGGETRQVFSGIKSAYKPEELEGKLTVMVANLKPRKMKFGM
SEGMILAAGPGGSDLWILEPHEGAQPGMRVM
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgatccaagacctctttcttcaagaaaaatgctggtaacttgtgcccttccg
tacgctaacggttcgatccaccttggccacatgcttgagcatatccaagcggacatttgg
gttcgttaccaacgcctacgcggcaacactgtaaacttcatctgtgctgacgatgctcac
ggcacgccaatcatgcttaaagcgcaacagatgggtattactcctgaagagatgattgcc
gcagttagcgaagagcatcaaaaagactttgctggctttgatatcagctttgataactac
cacagcacgcactcagaagagaaccgcgagctggcttcgcatatctaccttgagctgaag
aaaaacggctttatctctagccgcactatttctcagctattcgatccagaaaaagaaatg
ttcctaccggaccgttttgtaaaaggtacgtgccctaaatgtaagtctgaagaccagtac
ggtgacaactgtgacaactgtggtgagacttacagcccgacagaactgatcaatcctaaa
tctgccgtttctggtgcaactccagtaatgaaagattctgagcacttcttcttcgacctg
cctcagtttgaaagcatgctaaaagagtggactcgctctggctctctacaatctgaaacc
gcaaacaagatgcaagagtggtttgaatctggcctgcaacaatgggacatctcgcgtgat
gcgccttactttggtttcgagatcccaggtgagaagaacaagttcttctacgtatggcta
gacgcacctatcggctacatgggctctttcaaaaacctatgtgacaaacgcgacgatcta
gacttcgacgagtactggaacaaagacagctcagctgaactgtaccacttcatcggtaaa
gacattgtttacttccacagcctattctggccagcaatgctagacggttctggcttccgc
aagccgaacaacgtattcgtacacggttacgtaacagtaaacggtgcgaaaatgtctaag
tctaaaggtaccttcgtcaaagcgagcacttacctagagcacctagacccagaatgtctg
cgttactactacgctgcgaagctaaacagccgtatcgatgacctggatcttaaccttgaa
gacttcactcagcgcgtaaacgctgacgttgtgaacaagatcgttaacctggcatcacgt
aacgctggcttcatcgcaaaacgttttgaaggcaaactttctgacaactttgcagagcct
gagctgtacaacgagttcgttgctgcggctgaccgtatcgctgagctttacgaaacacgt
gaatttggtcgtgcaatccgtgaaatcactgcgctagcggacaaagcaaaccaatatgtt
gacgaaaaagcaccatgggttgtggcgaaggaagaaggcaaagatcaggaactacaagaa
atctgttctgtgggtatcaacctgttccgcgtgctgatgacttacctaaaaccagtaatg
ccagcacttgctgcacgtactgaagcgttcctaaaccaagaactgacttgggaaaacatc
gctgcgccgctaacaggtcacgaaatcactaagttcaaagcactgttcaaccgtattgat
cctaagaacatcgaagcgatgatcgaagcgtcaaaagaagatgcggcggcagaaatggcg
gcgaaagagaaagccgaagcagaaaagaacaaggctagccaaactgaactagacaaagat
ccaatcgcagaagagattgagttcgacgcttttgctgcagtggatatgcgtatcgctcga
atcatctcttgtgaagaagtaccaaaagcaaacaaactgcttaaattccagctagatatc
ggtggtgaaactcgccaagtgttctctggcatcaagtcagcgtacaaacctgaagagcta
gaaggcaagctaacggtaatggtagcaaacctcaaacctcgtaagatgaagtttggtatg
tcagaaggcatgatcctagcagcgggccctggtggcagcgacctatggatccttgagcca
cacgaaggcgctcaacctggcatgcgcgtaatgtaa

DBGET integrated database retrieval system