KEGG   Vibrio sp. EJY3: VEJY3_12095Help
Entry
VEJY3_12095       CDS       T01683                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vej  Vibrio sp. EJY3
Brite
KEGG Orthology (KO) [BR:vej00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vej03016]
    VEJY3_12095
Enzymes [BR:vej01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     VEJY3_12095
Transfer RNA biogenesis [BR:vej03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    VEJY3_12095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AEX22895
Position
1:complement(2691444..2692220)
Genome map
AA seq 258 aa AA seqDB search
MSEQETSQAVSPVELEIVYQDEYFVAVNKPAGMLVHRSWLDKHETQFVMQTLRDQIGQHV
FPLHRLDRPTSGVLVFALSSEVASQVMPMFAEHKMEKTYHAIVRGWIEEEGVLDYALKVE
LDKIADKFASQEKEAQEAVTAYKPLAKVEVPYSTGKFPTTRYCLVEMKPKTGRKHQLRRH
MAHLRHPIVGDTSHGDGKHNKLYRTEFDSHRLLLHASELRFVHPFTNEEIVMKANIDETW
QQLFARFEWDEGLVSPKS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaagaaacatcacaagccgtttctccagtggaattggagattgtttatcaa
gatgaatactttgtagcggtgaacaagcctgccggtatgctggtacatcgtagttggtta
gacaaacacgaaacccagttcgtcatgcaaacgttgcgtgatcaaattggtcagcacgtt
tttcctctgcaccgtttagatcgaccaacgtctggagtactagtgttcgcactttccagt
gaggtcgcatctcaagtgatgccgatgtttgctgagcataaaatggaaaaaacctatcat
gccatcgtgcgcggctggattgaggaagagggtgttttagattacgcgcttaaagtcgaa
ttggataaaattgcggacaagttcgcttctcaggaaaaagaagcgcaagaagctgtcacg
gcttataaacctctggcaaaagttgaagtgccgtactctaccgggaagtttccaaccacg
cgctattgtctagtggaaatgaaacccaaaacgggacgtaagcaccagcttcgtcgtcat
atggcccacttacgtcatccgatcgtgggtgacacttctcatggtgatggtaagcacaac
aaactgtatcgaactgaatttgattctcaccgtttgttattgcatgcatcagagcttcgt
tttgttcatccgtttaccaatgaagagatcgtgatgaaagcgaatatcgatgagacatgg
cagcagttatttgctcgatttgaatgggatgaagggcttgttagtccaaagagctaa

DBGET integrated database retrieval system