KEGG   Vibrio sp. EJY3: VEJY3_15080Help
Entry
VEJY3_15080       CDS       T01683                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00860  Porphyrin and chlorophyll metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
Module
vej_M00121  Heme biosynthesis, glutamate => heme
vej_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VEJY3_15080 (hemD)
Enzymes [BR:vej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VEJY3_15080 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PIG-H
Motif
Other DBs
NCBI-ProteinID: AEX23487
UniProt: H2IF06
Position
1:3379698..3380426
Genome map
AA seq 242 aa AA seqDB search
MAVLVTRPGEQGIELCSLLERHGIPAYHHPLIDIVADLSDTQLSDHLNHAHFIIAVSRHA
VQCAQQILSNNGISWPKHAIYLAVGQKTAHYLSKCTQQKVHYPQVSDSEHLLQLPALNNV
EKQNVVILRGNGGRELIKDALVRRGAKVHYSETYKREFIPFDPVSCVSLWKAQQINQIIV
TSGEQLDYLCSQLTSDQLAWLNQRELYIPSQRIADIAIQKGFTQVRCTGSASNQELLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgttggtcactcggccgggagagcaaggcattgagctttgctctctgctcgaa
aggcacggcattcccgcataccaccatccattgatcgacattgttgccgatctttcggat
acacagctctccgatcacctcaatcacgcacacttcattattgctgtcagcagacatgcc
gtgcagtgcgcacagcaaatattatcaaacaacggtatatcatggcctaaacacgccatt
taccttgccgttggtcaaaaaacagcacactatttaagcaaatgcacgcaacaaaaagta
cactatcctcaagtcagtgatagtgaacacttattgcaacttccagcgttaaacaatgta
gaaaaacagaacgttgttattctgcgtggaaacggtggaagagagcttattaaagatgca
ttggtgagacgtggagcaaaagttcactatagtgagacttacaagagagaattcatccca
ttcgatccagtaagctgtgtctcactatggaaagcccaacaaatcaatcagatcatcgtc
actagtggtgaacaacttgattatttgtgcagccaattaacgtcagatcaattggcttgg
cttaatcaacgagagttgtatatacccagtcagcgtatcgccgacatcgcaattcaaaag
gggttcactcaggtgaggtgcacaggaagcgcatccaaccaagaattactggctgctctc
cagccctag

DBGET integrated database retrieval system