KEGG   Vibrio sp. EJY3: VEJY3_17136Help
Entry
VEJY3_17136       CDS       T01683                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00620  Pyruvate metabolism
vej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_17136
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vej02000]
    VEJY3_17136
Enzymes [BR:vej01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     VEJY3_17136
Transporters [BR:vej02000]
 Other transporters
  Primary active transporters [TC:3]
   VEJY3_17136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEX23848
Position
2:complement(294368..296155)
Genome map
AA seq 595 aa AA seqDB search
MSESKKTIGITDVVLRDAHQSLFATRLCLDDMLPIAQQLDEIGYWSLECWGGATFDSCIR
FLGEDPWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVDKFVERAVSNGMDVFRVF
DAMNDPRNMQQAITAVKNNNAHAQGTLCYTTSPAHNLQTWVDVAQQLSEIGVDSIALKDM
AGILTPYKAEELVSTLKKQVDVPLHLHCHSTAGLADMTVIKAIEAGVDRVDTAISSMSGT
YGHPATESLVATLKDTPFDTGLNIEKLESIAAYFRDVRKKYAAFEGQLKGSDSRIIVAQV
PGGMLTNMESQLKQQNAADKLDQVLIEIPKVREELGFIPLVTPTSQIVGTQAVINVLMGE
RYKTITKETAGVLKGEYGRTPAPVNVALQARVLDGEQPITCRPADQLPPELDTLISDVKS
QAQEKNLTLADDLIDDVLTIALFPQVGWKFLENRNNPDAFEPKPSASQSNQANTEKSKMT
QQPSTYTITVNNQTYVVEVNEGGDITQVAPAAAQPAPSVPAPAANSEPMNAPLTGNIWKI
HAKPGDTVEEGQVLLILEAMKMETEIRAPRTGQIASIEVSEGDAVDVGAPLLQIA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagtcaaaaaaaaccattggcattactgacgttgtcttacgtgacgcgcatcaa
tcgttattcgcaactcgtctttgcttagatgacatgcttcctatcgctcagcaacttgat
gagatcggttactggtctctggaatgttggggtggcgccacttttgacagctgcattcgc
tttcttggtgaagacccatgggtacgcctgcgcgaactgaaaaaagccatgcctaaaacg
cctctgcaaatgctgctgcgtggtcaaaacctgttgggctatcgtcattatgctgacgat
gtggtggataaattcgtcgaacgcgcggtgagcaacggaatggatgtattccgtgtcttt
gatgctatgaacgacccgcgcaatatgcagcaagccatcaccgcagtaaagaataacaac
gctcatgcccaaggcacactgtgctacaccaccagcccagcgcataacttacaaacttgg
gttgatgtggctcagcaactgagcgaaattggagtcgattccatcgcgctaaaagacatg
gctggcattttaacgccatacaaagccgaagagctggtctcgaccctgaaaaaacaagtc
gatgtaccgctgcatctacactgccactctactgctggccttgcagatatgacggttatt
aaagccattgaagcaggcgttgaccgcgttgataccgctatctcttcaatgagcggcact
tacggccatccagccaccgaatcgttagtcgcgacgcttaaagacacaccatttgatacc
gggcttaatattgaaaagctggaatctattgccgcttacttccgcgacgtgcgtaaaaaa
tacgccgcctttgaaggtcagctaaaaggctcagattcgcgcatcatcgtcgcgcaagtt
ccaggtggcatgctcaccaatatggaaagtcagctcaagcaacaaaacgcggcagacaaa
cttgatcaagtgctgattgagattccaaaagtacgtgaagagcttggctttattccgttg
gtaaccccaacctcacaaattgtcggcactcaagcggtgatcaacgtattgatgggagag
cgttacaaaaccatcaccaaagaaacggcgggcgttttaaaaggtgaatacggccgcact
ccggcaccagtcaacgtggctttacaagctcgcgtactcgacggtgaacagccgataacc
tgccgtccagcagaccaattgccgccagagctcgataccctgattagcgacgtaaaatct
caggctcaagagaaaaacctcacgcttgccgacgacctaatcgatgacgtattgaccatc
gcactcttccctcaggtaggctggaaattcctcgaaaaccgcaacaacccagatgcgttt
gagccaaagccatcagcatctcaatctaatcaagcaaatacagagaaaagtaaaatgaca
caacaaccaagcacgtacactattaccgtaaacaaccaaacgtatgtggttgaagtcaat
gaaggcggcgatatcacccaagtcgcaccagctgctgcacaacctgcaccaagcgtccca
gcaccagctgccaactccgagccaatgaatgctccgctgaccggtaacatttggaaaatt
cacgctaaaccaggtgataccgtagaagaaggccaagtcctgctgatccttgaagcgatg
aaaatggaaaccgaaatccgcgctccgcgtaccggtcaaattgctagcatcgaagtctct
gaaggtgacgccgttgatgtcggtgctccactactgcaaatcgcataa

DBGET integrated database retrieval system