KEGG   Vibrio sp. EJY3: VEJY3_17606Help
Entry
VEJY3_17606       CDS       T01683                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00071  Fatty acid degradation
vej00072  Synthesis and degradation of ketone bodies
vej00280  Valine, leucine and isoleucine degradation
vej00310  Lysine degradation
vej00362  Benzoate degradation
vej00380  Tryptophan metabolism
vej00620  Pyruvate metabolism
vej00630  Glyoxylate and dicarboxylate metabolism
vej00640  Propanoate metabolism
vej00650  Butanoate metabolism
vej00900  Terpenoid backbone biosynthesis
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej01130  Biosynthesis of antibiotics
vej01200  Carbon metabolism
vej01212  Fatty acid metabolism
vej02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_17606
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_17606
   00640 Propanoate metabolism
    VEJY3_17606
   00650 Butanoate metabolism
    VEJY3_17606
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VEJY3_17606
   00072 Synthesis and degradation of ketone bodies
    VEJY3_17606
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEJY3_17606
   00310 Lysine degradation
    VEJY3_17606
   00380 Tryptophan metabolism
    VEJY3_17606
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VEJY3_17606
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VEJY3_17606
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VEJY3_17606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vej04147]
    VEJY3_17606
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VEJY3_17606
Exosome [BR:vej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VEJY3_17606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEX23942
UniProt: H2IK44
Position
2:393779..394987
Genome map
AA seq 402 aa AA seqDB search
MEKVYIVAAKRTPIGAFGGSLKNTSAGNLAAVAIKGALEAANLGSDKIDEVIVGNVVSAG
QGMGVGRQAAIFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAQVVVAAGVEVMSQ
IPFIVPSSVRDGNKMGNMELKDLLITDGLTDIYNQYHMGVTAENVAKEVGISREQQDAYA
LASQQKAVAAIEAGKFKDEIVPVEVTHRRETIIFDTDEYPKANATLEGLSKLRPAFDREG
TVTAGNASGINDGASAIIVASESAVQAHGLTPLAEVVSYAQSGIDPKIMGLGPVESVNKA
LKKAELNIQDIDVYELNEAFAAQALGVIHQLAETNQVPVSSIQDKANFNGGAIALGHPLG
ASGNRILVTLVHELHKQDAQYGVASLCVGGGMGTAVILKAIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttatatcgtagcagcaaagcgtacacctattggcgcatttggtggaagt
ttaaaaaatacttcagcaggcaatctggcagcagtcgcaattaaaggggcgcttgaagct
gcaaatctcggaagcgacaagattgatgaagtgattgttggtaacgtcgttagtgctggc
caagggatgggcgttggtcgccaagcggcaatatttgcgggtattccggagtctgtacca
gcgtatggcgtcaacatggtttgtggtagtggcatgaaaaccgtgatggatgcggtttct
cacattcgaagcggtgatgctcaagtggttgttgctgcaggcgttgaggtgatgtctcaa
atcccgttcatcgttcctagtagcgtccgcgatgggaataaaatgggcaacatggaactg
aaagatctattgatcaccgatggcctaacggacatttacaatcagtaccacatgggtgtg
actgcggaaaatgtggcaaaggaagtgggcattagccgcgagcagcaagacgcgtatgct
ttagccagccaacagaaagcggttgccgcgattgaagcaggcaaattcaaagatgaaatc
gtaccggttgaagtaacgcaccgccgtgaaacgattattttcgacacagacgaataccct
aaggcaaacgcgacacttgaaggcttgagcaagcttcgcccggcatttgaccgtgaaggt
acagtcacagcgggtaatgcatcaggaatcaacgatggtgcgagtgcgatcatcgtggca
tcagaaagcgcggttcaagctcatggtttgacacctctggctgaggttgtcagctatgcg
cagtcaggtatcgatccaaagatcatggggctagggccagtcgagtcagtgaataaagcg
ctcaagaaagcagagcttaatattcaggatattgatgtatacgagctgaatgaagccttt
gccgctcaggctcttggggtgattcatcagttggctgaaacaaaccaagttccagtcagt
tcgattcaagataaagcaaactttaatggcggtgcgattgcattaggtcacccacttggt
gcctctggcaaccgaattctggtcactttagttcacgaacttcataagcaggacgcccaa
tacggtgtagcttcactgtgtgtgggtggcggtatggggacagctgtcattctaaaagca
attaagtaa

DBGET integrated database retrieval system