KEGG   Vibrio sp. EJY3: VEJY3_22366Help
Entry
VEJY3_22366       CDS       T01683                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00625  Chloroalkane and chloroalkene degradation
vej00680  Methane metabolism
vej01100  Metabolic pathways
vej01120  Microbial metabolism in diverse environments
vej01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    VEJY3_22366
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VEJY3_22366
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     VEJY3_22366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc PALP FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEX24886
UniProt: H2IJ60
Position
2:1481257..1482459
Genome map
AA seq 400 aa AA seqDB search
MSYEKSNRAVVYKGPGKVAVESIPYPELALGNRKCEHGVILKVLTTNICGSDQHMVRGRT
TAEEGLVLGHEITGIILEKGRDVEFVDVGDIVSVPFNIACGRCRNCKSGMTGICLNVNPA
RPGAAYGYVDMGGWVGGQSEYVMIPYADFNLLKFPDPDQAREKIKDLTLLSDIFPTGFHG
CVTAGVGPGSTVYIAGAGPVGLAAAVSAQLLGAACVIVGDMIPDRLEQARSFGCETIDLR
EDGSMEDKIEAILNEREVDCFVDCVGFEAHGCGCGGHTQEAPATVLNSAMQVTRAGGSIG
IPGLYVTDDPGAKDEAAKEGALSMRFGLGWAKSHSFHTGQCPVMKYHRGLMQSILFDKVK
IADAVNVQMISLDQAPQGYADFDGGAAKKFVIDPHGEFSK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaaaaatcaaaccgcgccgttgtttacaaaggcccgggcaaagttgctgtc
gagtcaattccatacccagaactcgcattaggcaatcgtaagtgtgagcacggcgtaatc
cttaaagtgctgacgaccaatatctgtggcagcgaccaacatatggtacgtggacgtaca
accgctgaagaaggcttagtacttggtcacgaaatcacgggcatcattttagaaaaaggc
cgcgatgtcgagttcgttgatgttggcgatatcgtttcagtaccgtttaacattgcttgt
ggccgatgccgcaactgtaaatcaggcatgactggtatctgcctcaacgtaaaccctgct
cgtcctggtgcggcatacggttatgttgatatgggcggctgggttggcggccaatcggag
tacgtaatgataccgtacgctgactttaacttacttaagttcccagatccggatcaggca
cgagagaaaattaaggatttaacactactgtctgatatcttccctacgggtttccatggc
tgtgtaaccgcaggtgttggtcctggttctaccgtttatatcgctggtgcaggtcctgtg
ggtctggcagcagcagtatcggctcaactacttggcgccgcttgtgtcatcgttggagac
atgatcccagatcgtctagaacaagcacgtagttttggttgcgaaaccattgacctacgt
gaagacggcagcatggaagataaaattgaagcaattctgaatgagcgtgaagttgattgt
tttgttgactgtgttggtttcgaagcgcacggatgtggctgtggtggtcacactcaagaa
gcaccagcaacagtactgaactctgcgatgcaagtaacgcgtgccggtggttcgattggt
attcctggtctttacgttacagacgatccgggtgcgaaagacgaagctgcgaaagaaggt
gcactgagcatgcgctttggtcttggctgggcgaaatcacattctttccatactggccaa
tgcccggtaatgaaatatcaccgtggtctgatgcaatctattttgttcgacaaagttaaa
attgctgacgccgtaaacgtacaaatgatttcactcgatcaagcacctcaaggttacgcc
gactttgatggtggtgcagctaagaaatttgttattgacccgcacggtgaatttagcaag
taa

DBGET integrated database retrieval system