KEGG   Vollenhovia emeryi: 105558390Help
Entry
105558390         CDS       T06016                                 

Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
vem  Vollenhovia emeryi
Brite
KEGG Orthology (KO) [BR:vem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vem01001]
    105558390
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vem04131]
    105558390
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:vem04812]
    105558390
   04147 Exosome [BR:vem04147]
    105558390
Enzymes [BR:vem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105558390
Protein kinases [BR:vem01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105558390
Membrane trafficking [BR:vem04131]
 Others
  Actin-binding proteins
   Others
    105558390
Cytoskeleton proteins [BR:vem04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105558390
Exosome [BR:vem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105558390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Spectrin SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 105558390
NCBI-ProteinID: XP_011861435
Position
Unknown
AA seq 3889 aa AA seqDB search
MMMVDGPDSMEAHVHPEGSVEMNSGIVMQRDEDTPQIISPTTTISTIAVQSGDTRVVIAL
LQSGEWLKLKILELQPELTKLGASVKEATELSNAHDQVLLRLQNKQSPVEELLRQADHLI
ATQRPRAEVYTAMAETLGQAWRDVNQLLERRKEILDQNVLFQCRAAECRERMEALEMACN
DTLLPIEIEAVKSFLSKIQDLRKDMLESLMGALREGKSLLDGLKELVNEGTLDSRPDTIK
AEANHAVLRVEKWLEELHDRRRLIETSFRSRKTQLEQCLALALLATDLRDLEEILNDRIT
ALEGSCDQLGDSVSSVELLLFELKKLQVEAKEFQDRAIKITKSTERLVSSGHFAGEQATE
QAYAILSTAADYINDLDQYNILLNRAIAFFDYAQSAITKLDQLEIQLMTTEYPPYSARLA
RFHAQTVATIEDITSRPLSEGYTLLDITGKEVSGAEGVRNTIEKLENRKFCLMERCTAHK
EENVEVSRILAAFSDKHDALQAWLTNTAKAFLQKHHDMGSDLAMARDFRQVHCQLLAELK
SKSEEVDHLELEIIPIIERLDEIQKYELQLKIKNLEDEWTKTKITMVKRIDLGTIYVQFH
EIVEQLTHETDSIDNELKKHEAVLNEPRFNELEKKWKSFESLYKKLDNQAKVFLNETSKI
DDCYLGISQACLCVETLLEKFANRQLVLLESREKWQTAIQITRQKRIECEQKVQESTRTL
EWITKLEATLYPMIITRSSRIVDILDNLEDVRKRIILELNKALQELDVRIKSIQVFVERG
ETKVAEQISERLVQMHEKMNTIVKDYEILLESLISIFKNLEKIERKIEEAKQETEYASSS
TKLIDVDGSLNKLDIIKTFIAESLRRARTKSEAVINNIKLQEPPESAIQDIEKLKRTIDS
MSVKFESFQTETSSHLEKHRRLCIFREDLEKINSDLRELHEQLKNMDGKIGDNLSVSKAT
LAAFEQFEQTIMILEERIETFVKKTEGTIVPLTPQVTDEILSLRNRWDHLMKYVRDTKKR
MNLSIDYFVLLEEAKQWFREGSKLLVIVARKATTVKVSEEATDLLREIDTYVKPGEEQQE
RRIEKLKQLSTIVFGTDRLPQFNEVVVENRQMLDSFVVISSELRTLSQNLQNAEDLREKL
QIEKLEADKKLQAAKIEMAAAEAAKMEAENAKKLAEQLAAEALDKAAIEVKRLKEEEARK
IPVSHSVSAQTDETIIEETITSAVTTKEIHILQQTEVEKSVPVIRKETSPPRESVSEEKQ
AQTDKIASLAPEFTIPLRDAMVQEGKEFSLECHLIGQPIPEIIWYKDGISILNNPDYLTT
YANGVCTLKIEETFAEDSAKYTCRAFNILGSVETSATLTIKETITEEQPSAPVFVKELQP
SFAREGCCHKLECTVKGNPLPTVQWYKNDINIDNSPDYVITFNNGEAILKFDEVFLEDKA
SYTCKATNQWGQSSTTTFLDVKPAQISAKKPYFVVPLSNIMVRAGQEVKLECEANGDPVL
ELIWTHDGKPFEESKHHKIQTNGAQTCLIIAEAFPKDAGSYTVTASNEIGKATSTCTVFV
KERSLHETSESDFICSDTKPITPKFQLPLQDLKIQEGQSARLDCVIVGQPEPEVIWYHDE
QPVKESSDFQLLFQGDRCSLVIHEAFLDDAGVYKVVAINSGGEASSQCTLTIMPPRTLNV
IDRVEKQEGTLASGSVPKFVKLPTDLLVAESENAIFECAVIGEPKPDLKWYSDDGEMIQD
GRILIGERKDGTAFLQISSTIKEDKGNYVAKAINTHGEAKAFARLVVKSLGDFKRNEEFI
QMEEKLIQPTFKEKFQDRKVLEGVSTKFECIATGKPSPKIQWFFNGRTVHGKDFLVSVSG
DRQVLTIPVVGDAHVGTISCIAENTAGRAVCSAKIEIDSGSVRPAASEVKEVFELVPYFP
AGTMHPASSSDKHISREKTYDEGGGESQVLTKMSSTVTHSSTMSTKKEFSSSTMTSTLSQ
SGHEPISVSTKTTVQSSEQSTSENGAPPVVQSQKIEEYEKIIQEQPGEMRQEKTVLVSEE
TEGVKRDVKTSQVQKPSRKLIAPRFISPITGMIVDQGADVVLEGIVDGFPQPTILWSKNG
QELTLKDNIKTSYAHNHVKLELRNVNVKDAGRYTCKVSNDVGSASSTADLVVKKTIFPPV
FGKRLKAQVIKKGDRVIMEVEITGIPEPTVSWYKNDMPINEQPPRLKIIQQGNCYTLFID
KVREEDAGKYMVRATNAGGEAQSIADIAVFEPKPDTMVEVHKTVTYENIQDKSVVQSEGK
REEMASSISTSEQTPTTAIAFVGLKPATLASTTIDMVQKIDEPEIQASKSETISSIIESH
ETKTKSEQMFHMKLEHKTPSIVESAPRIEQTITTKEVDRDKKDVTKPLIQTEERSTIDNE
NVETSTIAKKDALSFFESITKESEIMPKGPKEMIKLTEDGQTQEATVGKLTKNYERVSVY
QEAKKPEAKLSGFQTTKKAAQDIFTKLEQGSSSRGVDNKLFEFPYESPRLPSTEIQKTAE
ERITSGTSISQIQTRSSETMMKSFDLVPEPPPEICYMPKPEEMKKKRPEVFVKAKQLQES
FDKTLSPIDAPVGGVKIFPTSTPKAPEPFKAAEPILTCTIPPPFELEKKETFEKTCVKKD
AYEKKESKYFKEEKMEPSKCTSTSILRSTSPVIRPWSSSSDVETKSHVSTDLSEYRCHSA
ASSHQEILRSTSPKPSIDALTMEKSWAKKYVDSNRKSWPPQTQAIQKYDWNIPVDEYKSS
SREFEQKIEETPQGGIKKISTESSANVEKRSWSSKEKFTEKITEASPPTFKLGPIIYNAE
TIKVDHTVNTVQEKALFEKYITECNMEKAETIQKMEDFSSKRWAEDKELKAPSLVKKVEP
TTKSLVIPHRPMETKVDSIVLEPGSPPEIGYIPPPVAKEKTALEYTKIEKRVEEPPVLPP
KDVRITPPPVPTKKPIKLSTPVPSRFIKGSFSHESDYESDFDNRLKAKWRPYESDSEEPH
YRRVKAPVPKQPRPRSTEPEPLPPSKFETPSQFPGLSKSLVATESSEKAARKITFKRHER
EFKQQQQQQQQQQQQQQSPISLKPGSPPIYVQPSTKSSAPKSPIKKPESPKFKTKVFQQE
SGYMADTDEPFQQKASSMTMQKFVGKRDGPSTMVHTESRTTCTESRTKSFESHSYKSDHL
RKEETSFVSPTVCSAPATPKTVHQQRSSLEKSYASSTSSDLRRSESMKETGYSINQLHRK
LEPAEKVLSTSPGPSKLMKGDFRESDYESDYDGKTSLSHTVSSTKFSAADLGKSTEPILP
RKQHTVVVPAKPKTVLLPGSPPELAYAPPQSQQQFYEAHTGVPFTNAMGTEMKKTVRMDE
STENARRIVTVEQTSRVIKFGDTPAQKQQTTNYYVPKPRKFVQGQFRESDYESDVDSSRI
RPKWTPADSDTEEPYYRRVQPPTGRSVRSLSAPVRQTHIASPMEFDTSPPTTSLTQIRRE
DMDEKINFQKYQQRTTSGKTDNVLQPGAPPEYGFISRSGVKRAAGHIASRHMSDMTSSFK
SKTEKFVSDIQSDLRQGKPILKHPNDSKVTDTDEPRTYREESRVTEHGTKQIDPDTGLIY
FKYDFGYEFGIVLPGEGKKTVESSKKSIQGQRRSSDIEVPIIHEFTEKKANGYMKKGTFL
NRQSKIGNKFGNSKTVKWEPTSESEFSETEDTKNLNKKQSNKRDIECSMTPPSLVIPSSM
SPSRWDRTTPSPLSLSPSLPSLSPRQSSATGPPSNVDSAGSPWPISNGVSSSKEVIQPYL
EILPKKAPTFITPLKDIAVVSGQPARFECIVQAEPQPNILWSKDHRIVENSKSHEVQYRN
GVCRLTITRALPEDAGTYVCTATNSLGSTVTSANLEVPGNRRSIYAPTS
NT seq 11670 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggtggatggtcctgactcgatggaggcacacgtgcatcccgaaggatctgtt
gaaatgaattcaggaatagtgatgcaaagagacgaggatacgccgcaaatcatctcacca
actactactataagtactatagctgtgcaaagcggagacacgcgtgtagtaatcgcttta
cttcaaagcggtgaatggctaaagctgaaaatactcgagctacaaccagaattaacgaaa
cttggtgcttccgtaaaagaagccacggaactctcaaatgcacacgatcaagtgttactt
cgattacagaacaaacaaagcccggtggaagagttattgcgacaagctgatcatttaatc
gcgactcagagaccaagagcagaagtgtacactgccatggcggagacattaggtcaggca
tggcgtgatgtaaatcaacttttagaacgtcgtaaggaaatactcgaccaaaacgtatta
tttcaatgtcgcgcggcagaatgtagagaaaggatggaagcgttggaaatggcgtgtaac
gacacgttactaccgatcgagatagaagcagtaaagagctttttatcgaaaattcaagat
cttcgaaaagatatgttggaatcattgatgggtgcgttgcgagagggtaaaagtttgctg
gatggactcaaggaattggtaaacgaaggcactttggattctaggccggatacaattaaa
gctgaagctaatcatgctgtgttgcgagttgaaaaatggctggaagaacttcacgataga
aggcggctgatcgagacatcttttcgtagcagaaaaactcaattggagcaatgtctcgct
ctcgcactacttgcaaccgatcttcgcgatctcgaagaaattctcaatgacagaatcact
gcattggagggcagttgcgatcaattgggagattccgtatctagcgtggagctgcttctt
tttgaattaaaaaagttgcaagtcgaagcaaaggagtttcaagatagggctattaaaata
actaaatcgaccgaacgattagtgtcatcgggacactttgcaggcgaacaagcgaccgaa
caggcatacgcgattcttagcaccgctgccgattatatcaacgacttagatcaatacaat
atattgttgaatagggcaatagcctttttcgattatgcacaatcggctatcacaaaactg
gaccagctggaaattcagttgatgacaacggagtatcctccttattcagcacgactggca
cgttttcatgcgcaaacagtggctacgatagaagacataacttcaaggccattgtcagaa
ggatatacgcttctagatatcacgggaaaagaagtatctggtgccgagggtgtaaggaat
actatagaaaaattggagaatcgcaaattttgtttgatggaacgatgtacagctcataaa
gaagaaaatgtggaggtttcgagaatacttgctgcattttcagataagcatgacgcatta
caagcttggctaactaataccgccaaagcctttcttcaaaagcatcacgatatgggcagc
gatctggcaatggcacgtgattttcgccaagttcattgtcaattgctagctgaattgaaa
agtaaaagcgaggaggtagatcatttagaattggaaattattccaatcatagaacgcctg
gacgaaatacagaaatacgaattacaattaaaaataaagaatcttgaagacgaatggacg
aaaacaaagattacaatggtaaaaagaattgatttggggactatttatgtacagtttcat
gaaattgtggaacaattgactcatgaaacagactctatcgataatgaattgaaaaagcat
gaagctgtgttaaatgagcctaggtttaatgaactagaaaagaaatggaaatcttttgag
tcactttataaaaaacttgataatcaggcgaaagtatttctcaatgaaacgagcaaaatt
gatgactgttacctcggtatatcgcaagcttgtctgtgtgttgagactctcttggaaaag
tttgctaatcgacaactggttttgctagagtcaagagaaaaatggcagactgctatccaa
ataacgagacaaaagcgaatagaatgtgagcaaaaagtacaagaaagtacaaggacatta
gagtggattacaaaacttgaggcaacactgtatccaatgataataacacgatcttccaga
atagttgatattttggataatttggaagatgtgagaaaacgaatcatacttgaattgaac
aaagctcttcaggaattggatgttcgaatcaaaagtattcaagtatttgtcgaaagaggt
gaaactaaagtagccgagcaaatctcagagagactcgtgcaaatgcatgaaaagatgaat
actatcgtcaaagattacgaaatattgttagaatctttaatttctatctttaagaatcta
gagaagatcgagcgtaaaattgaagaagcaaagcaagaaactgaatatgcatcaagttct
accaagctgattgatgtggatggttctttaaataaacttgatataataaaaacatttatt
gcggaatctttacggcgagcacgtacaaaatctgaagcagtaattaacaatattaaacta
caggaaccgccagaatcagcaatacaagatattgagaaactaaaacgtacaatagactcc
atgagtgtcaaatttgaatcgttccaaaccgaaacgtcaagccatcttgaaaaacatcga
cgtctttgcatttttagagaggatctcgaaaagattaattcggatctacgtgaattgcat
gaacagctaaagaatatggacggaaaaattggtgacaatttatcagtatcgaaagcgaca
ctagctgctttcgaacagtttgaacaaacaataatgattttggaagagagaattgagacc
tttgtaaaaaagacagaaggaacaattgttccattaactccacaagtgacggatgaaatt
ttatctctgcgaaacagatgggatcatctgatgaaatatgttagggataccaagaagaga
atgaatttaagtattgactatttcgtactcttggaagaagctaaacagtggtttagggaa
ggtagtaaacttttagtaattgttgcacgtaaggcaacaactgtaaaagtctctgaagaa
gccactgatttactgcgagagattgatacttatgtaaagcctggcgaagagcagcaggaa
aggagaattgagaagctgaaacaattatcgacaatagttttcggtacagacagacttccg
caattcaatgaagtggtagtagagaatcggcaaatgctagactcctttgtagtcatttct
tccgagttgcgtactttgagtcaaaatttacagaatgccgaagatctccgagagaaattg
caaattgagaagctagaagcagataaaaaactgcaagctgctaaaatagaaatggctgcg
gcggaagctgcaaagatggaagcagaaaatgcgaagaagcttgcagaacagcttgccgct
gaagctttagacaaagctgcgatagaagtgaaaagattaaaagaggaagaagcacgaaaa
attcccgtttctcactctgtctccgcccaaactgatgagaccataattgaagaaacaatt
acttcggccgtgacgacgaaagaaattcatattctccaacagacagaagtcgagaaaagt
gttccggttatacgaaaggaaactagtccaccaagagagtcggtatccgaggagaaacaa
gcacaaacggacaaaattgcttcattggctccagaattcacaattcctttacgtgatgcg
atggttcaagaaggcaaagagttcagtttagaatgccacttaattggtcagccaatacca
gaaataatatggtacaaagatggaatatcaattttgaataatccagactatttgacaact
tatgcaaacggtgtttgtactttaaaaatagaagagacatttgctgaggattctgctaaa
tacacttgtcgtgcatttaatattcttggctctgtcgaaacatcggccactctcactatc
aaagaaactataacggaagaacaaccaagtgcccccgttttcgtgaaagaattgcagcct
tcttttgcgagggaaggatgttgtcataaattagagtgcactgttaaaggaaatcctcta
ccaacggtacaatggtacaaaaatgatatcaacattgataattctccggactacgttatt
acttttaataatggagaagctattttaaagtttgatgaagttttcttggaagataaagct
tcgtatacctgtaaagcaacaaatcaatggggtcagtcatctactaccacttttctggac
gtgaaacccgcccaaatttccgcaaagaaaccatattttgtggtaccattatcaaatatt
atggtcagggcagggcaggaagtaaaattggaatgcgaagctaacggagatccagttctc
gaattaatatggactcacgatgggaagccgtttgaagaaagcaaacatcacaaaattcaa
acgaacggtgctcaaacatgtttgatcattgcggaagctttcccgaaagatgccggatct
tatacagtgactgccagtaatgaaatcggaaaagccacctcaacttgtaccgtttttgtg
aaagaacgttcgcttcatgagaccagcgaatctgattttatttgtagcgacacaaaacca
ataaccccgaaatttcagttacctttgcaagatcttaaaattcaagaaggacaatcggct
aggctagattgtgtgattgtaggtcaacctgaaccggaggtaatttggtaccacgatgaa
caaccggtaaaagaatcatcagatttccaattactcttccaaggtgatcggtgttcatta
gttattcatgaagctttcttggatgacgccggtgtttacaaagtagttgctattaattct
ggtggcgaagcatctagtcagtgtacattaacaattatgccacctcgcaccttaaatgta
atcgatcgagtggagaaacaggaaggaactcttgccagtggttccgtgccaaagtttgtg
aaacttcctacggacttgctagtggctgaaagcgaaaatgcaattttcgaatgtgctgta
attggagaacctaagcctgatttgaaatggtattcggacgacggcgaaatgatccaagat
ggaagaattttgattggagaaagaaaagatggaacggcctttttacaaatttcatcaacg
ataaaggaagataaaggcaattacgtggcgaaagccataaacacacatggtgaggcaaaa
gctttcgctagattggttgtaaagtcactcggtgattttaagagaaacgaagaatttata
cagatggaagaaaaattgattcaaccaacattcaaagaaaagtttcaggacagaaaagta
ctggaaggagtttcaacaaaattcgaatgcattgccactggtaaaccttctcctaagatt
cagtggttctttaatggacgaacggttcacgggaaagattttctagtttccgttagtgga
gatcgacaagttttgacaattcctgtggttggagacgcacatgtcggtactatctcttgt
atagcggagaacacggctggtagagcagtttgtagtgctaaaatagaaattgatagtgga
tcagtgaggccggctgcaagtgaagtcaaggaagtgttcgagttagttccatattttcct
gcaggcactatgcatcctgcaagcagcagcgataaacacatttcaagagagaaaacatat
gacgaaggtggcggtgaaagtcaagtgctaaccaaaatgtcatcgactgtcacacattct
tcaacaatgtccacgaaaaaggaattttcatcatctactatgacttcgactttgtcacaa
tctggacacgaacctatcagcgttagcaccaaaacaactgtgcaaagttccgaacagtcc
acttcagaaaacggagcaccacctgtcgtacagtctcaaaaaatcgaggagtatgaaaag
atcatacaagagcaacctggcgagatgagacaagagaaaaccgttctcgtgtctgaagaa
acggaaggtgtaaaacgcgatgttaagacaagtcaagttcaaaaaccatctaggaaactg
atagcaccaagattcatttcacctattacaggaatgatcgtcgatcaaggagctgatgta
gttctcgaaggtatcgttgacggttttccgcaaccgacgattctatggtcaaagaacggt
caggagctgacattgaaggataatataaaaactagttacgctcacaatcacgtcaaattg
gaactgaggaatgtcaatgtgaaagatgctggacgttatacctgtaaagtgagcaatgat
gttggaagtgctagtagcacggctgacttggtcgttaaaaaaacaatatttccacctgtt
ttcggcaagcgccttaaggcccaagtaataaagaaaggtgatcgtgttattatggaggta
gaaattactggtattcctgagcctacggtcagttggtataaaaacgatatgccgatcaat
gagcaaccaccaagattgaaaattattcaacaaggaaattgctacacgctgttcatagac
aaagtcagagaagaagatgctggcaaatacatggtacgagcgacgaacgctggtggcgag
gcgcagagtatcgctgatatcgcggtttttgaaccaaagcctgatactatggtcgaggtg
cataaaactgtcacttacgaaaatattcaggataaaagtgtcgtccagtctgagggaaaa
agagaggagatggcatcaagtatttcaacgagcgaacaaacaccaacgacagcgatcgcg
tttgtcggattgaagcctgcaacattggcctcgactacaatcgacatggtgcaaaagatc
gacgaaccggaaatacaagctagtaaatcggaaacgatttcatctataatcgaatcccat
gaaaccaaaacgaagtcagaacaaatgttccatatgaaattggaacataaaactccatcc
attgtggagtccgcgcctcgaatcgaacaaacgattacgacaaaggaagtcgaccgtgac
aaaaaagatgtcacgaagccgttaatacaaacggaagaaagatcaacgatcgataatgaa
aacgtagagacttctacgattgcaaaaaaagatgcattgagtttcttcgaatctattacg
aaggaaagtgagataatgccaaaagggccaaaggaaatgattaagctgacggaagatggg
caaactcaggaagcgacggttggaaaattaacaaaaaattatgaacgagtatccgtttat
caagaagcgaagaaaccggaagcaaaactgtcagggtttcagacaacaaagaaggctgcc
caggatatttttaccaagttagaacaaggttcgtcgtctcgcggagtggataataaacta
tttgaatttccatacgagagtcctagactgccctcaacggagatacaaaagactgcagag
gaaagaataacttccggtacgtctatttcgcaaattcagacgaggagttctgaaacgatg
atgaaaagttttgatctagtgccggaaccacctcctgagatatgctacatgccaaaacca
gaagagatgaaaaaaaaacgacctgaagtatttgtcaaggcaaaacagcttcaggaatct
tttgataagacactctctcctatagatgctccagtcggaggtgtaaagatctttcctacg
tctactccaaaggcaccagaaccttttaaagccgccgaacctattctaacatgtacaata
ccgccgccatttgaactcgagaagaaagaaacatttgaaaagacatgcgtaaagaaagat
gcatacgagaaaaaggaaagcaaatatttcaaagaggaaaagatggaaccatcaaaatgc
acttcgacatcgattttgagaagtacttctcctgttatcagaccgtggtcttcatcatcg
gatgtagaaaccaaatcgcacgtgtctacagacttatcggaatatagatgtcattcagct
gcttctagtcatcaggaaattttgagatctacatcaccgaaaccatctatagatgcactg
acgatggaaaaatcttgggcgaaaaaatacgtagattcaaatagaaaatcgtggccacca
caaactcaagcgatccaaaagtacgattggaatattcctgttgatgaatacaagagctct
tcgagagaatttgagcaaaagattgaggaaacaccgcaaggtggaataaagaagattagt
acggaatcgtctgccaatgtagaaaaacgctcgtggtccagcaaagaaaaattcactgaa
aagataacggaagcatctccacctacgtttaaattaggtccgataatctataacgccgaa
acgattaaagtcgaccatactgtaaatactgtgcaagagaaggctttgttcgaaaaatac
ataactgaatgcaacatggaaaaagctgaaacaatacagaaaatggaagatttcagctcg
aaacgttgggcagaagacaaagagttgaaggcacctagtttggtaaagaaggttgagcca
accacgaaatcgcttgtgataccacatcgtcctatggagacaaaagtggactcgatcgtt
ctcgagccaggatctcctccagaaattggatatattccaccacccgttgcaaaagaaaaa
actgcattggagtatacgaaaatagaaaaaagagtagaggaaccacccgtacttccaccg
aaagatgtacgtattacaccgccccccgtcccaactaaaaaacctattaaactctcaaca
ccagttccatcaaggttcattaagggctcctttagtcacgaaagtgattacgagtctgat
ttcgacaaccgtctgaaagcaaaatggagaccttacgagagcgatagcgaagagccgcat
tatcgaagagtcaaggcacctgttccgaaacaaccaaggccgaggtccaccgaacctgag
ccactcccgccttcaaaattcgagactccttcacaatttccagggctatccaaatcactc
gttgctacagaatcttccgaaaaagcagcaagaaaaatcacatttaaacgacacgagcga
gaattcaaacaacaacaacaacaacagcagcagcagcagcagcagcagcaaagtccgatt
tctttaaaacccggttctccacctatttacgtacagccgagcacgaagagttcagcgccg
aaatctcctattaaaaaaccggaatctccaaagtttaaaacaaaagtttttcaacaagaa
agcggttatatggcggataccgacgagccattccagcagaaggcttcatccatgacgatg
caaaaatttgttggaaaacgcgacggtccctcgacaatggttcacacggagagtcgtacc
acgtgcactgaaagccgaacaaagtcttttgaaagtcacagttacaaaagtgatcatttg
cgaaaagaagagacttcctttgtctcaccaactgtttgtagtgcaccggcgactcccaaa
accgttcaccaacaacgcagctcgttggagaagagctatgcatcatcaaccagcagtgac
ctgcgtagatccgaatccatgaaggagacgggatattccataaaccagttgcatagaaaa
ttggaaccagcggaaaaagttttgtccacctctccaggtccttcaaaattaatgaagggt
gactttcgcgagagcgactatgagagcgactatgatggtaaaacatcgttaagccacacc
gttagctccacaaagtttagtgctgctgatttaggaaaatcaacagaaccgatcttgcct
cgcaagcaacatacagtagtagtaccagcaaaaccaaaaacggttctcctacctggctct
ccaccggaactcgcttatgcgccaccccaatcgcaacaacaattttacgaagcacataca
ggcgtaccatttacaaacgcgatgggcacagagatgaaaaaaaccgtgaggatggacgag
tcaacggagaatgctagaaggattgttactgttgagcaaacaagccgagtaattaagttt
ggtgacacacctgcccaaaaacaacaaacgactaattactatgttcctaaaccgagaaaa
tttgtgcaagggcaatttcgggaatctgattacgagagcgatgtagattcaagtagaatt
cgaccgaaatggactccagcggatagtgacaccgaggaaccatattaccgaagagttcaa
ccacctacaggaagaagtgtgagatctttgagtgcaccagttaggcagacacacatcgca
tcaccgatggagtttgacaccagtcctccgacaacgtcattgacgcagattcgcagagaa
gatatggacgaaaagatcaattttcaaaagtaccaacagcgtacaacttccggaaagacc
gacaacgttttacagcctggtgcaccgcctgaatacggatttatctcgagaagcggcgta
aaaagagcagcaggccacatcgcgtcgcgtcatatgagtgatatgacgagcagttttaaa
tctaaaaccgaaaagtttgtgagcgatatccaatcggatttgagacagggtaaaccgatt
ttgaagcatcctaatgactccaaggtaaccgatactgacgagccaagaacttatagagaa
gaatcgcgagtcaccgaacacggaacaaaacaaattgatccggatactggacttatatac
ttcaagtacgattttggctatgaattcggtatcgttttgcctggcgaaggtaaaaaaacg
gttgagagcagcaagaagagcattcaaggacagagacgttccagcgatatagaagtacct
ataattcacgagtttactgaaaagaaggcgaatggttatatgaagaaaggcacattttta
aaccggcagagcaagattggaaataaattcggaaactcaaaaactgttaaatgggagcca
acatcagagagcgagttttctgaaactgaagacacaaagaatctgaataaaaagcaatcg
aataagagagacatagaatgctcaatgacacctccaagtcttgtcatacctagctctatg
tcaccatcaagatgggatcgtacaacgcccagtccgctttctcttagtccaagcctgcca
agcctctctccgagacagagtagcgctactggaccacctagcaatgtggattctgcaggt
tcaccgtggccaattagcaatggagtatcatcgagtaaggaagtaattcagccttatctc
gaaatactaccgaagaaggctcctacattcattacgccgctaaaagatatcgcggtagta
agcggacaaccagctagatttgaatgtattgttcaggctgaaccacagcccaatatcctt
tggtcaaaagatcatagaatcgtcgaaaattctaagagccatgaagtccaatatagaaat
ggtgtttgtcgccttaccataacgagagctttacccgaggacgctgggacttatgtgtgt
acggcaacgaatagtttaggttctaccgtaacttctgccaatttggaggttccaggtaat
agacgatctatatatgctcctacttcgtaa

DBGET integrated database retrieval system