KEGG   Vollenhovia emeryi: 105559502Help
Entry
105559502         CDS       T06016                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vem  Vollenhovia emeryi
Pathway
vem03040  Spliceosome
vem04141  Protein processing in endoplasmic reticulum
vem04144  Endocytosis
vem04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:vem00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105559502
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105559502
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105559502
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105559502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vem01009]
    105559502
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vem03041]
    105559502
   03009 Ribosome biogenesis [BR:vem03009]
    105559502
   03110 Chaperones and folding catalysts [BR:vem03110]
    105559502
   04131 Membrane trafficking [BR:vem04131]
    105559502
   03051 Proteasome [BR:vem03051]
    105559502
   03029 Mitochondrial biogenesis [BR:vem03029]
    105559502
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vem04147]
    105559502
Protein phosphatases and associated proteins [BR:vem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105559502
Spliceosome [BR:vem03041]
 Complex B
  Other components
   Prp19 complex
    105559502
 Complex C
   Prp19-CDC5 complex
    105559502
Ribosome biogenesis [BR:vem03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105559502
Chaperones and folding catalysts [BR:vem03110]
 Heat shock proteins
  HSP70 / DNAK
   105559502
Membrane trafficking [BR:vem04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105559502
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105559502
Proteasome [BR:vem03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105559502
Mitochondrial biogenesis [BR:vem03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105559502
Exosome [BR:vem04147]
 Exosomal proteins
  Proteins found in most exosomes
   105559502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 105559502
NCBI-ProteinID: XP_011863236
Position
Unknown
AA seq 652 aa AA seqDB search
MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTETERLIGDAAKNQVA
MNPNNTIFDAKRLIGRRFEDPTIQADMKHWPFTVVNDSGKPKIQVQYKGETKTFFPEEVS
SMVLVKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKATGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVQEFKRKYKKDLTSNKRALRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELCADLFRGTLEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTI
PTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEKQKETIAAKN
GLESYCFNMKSTVEDEKLKDKISASDKQTILDKCNDIIKWLDANQLADKEEYEHKQKELE
GICNPIVTKLYQGAGGMPGGMPGGFPGAGGAAPGGAPSGGGAASGPTIEEVD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcacccgcagtcggtatcgatctcggcacgacttactcctgcgtcggcgtc
ttccagcacggcaaggtcgagatcattgccaacgaccaggggaaccgcacgacgcccagc
tatgtggccttcacggagaccgagcgtctcatcggagacgccgccaagaaccaggtcgcc
atgaaccccaacaacaccattttcgatgccaaaaggttgatcggacgtcgcttcgaggac
cccaccatccaagctgacatgaagcactggccattcaccgtggtaaacgacagcggcaag
ccaaagatccaagtacaatacaaaggagagacgaagactttcttccccgaagaagtgagt
tcgatggtcctggtaaaaatgaaggagaccgcggaggcgtacctgggcaagaccgtgacc
aacgccgtgatcaccgtccccgcttacttcaacgactcgcagcgtcaggcaaccaaggac
gctggtaccatctcgggcttgaatgtactgcgtatcattaacgagcccaccgccgccgcg
atcgcgtacggcctcgacaagaaggccaccggcgagcggaacgtcctgatctttgatctc
ggtggtggcaccttcgacgtgtccatcctgaccatcgaagatggtattttcgaggtcaag
tccaccgccggcgacacccatctcggcggcgaggacttcgacaaccgcatggtcaatcac
ttcgtgcaggagttcaagcgcaagtacaagaaggacctgacctcgaacaagcgcgccctc
cgccgtctgcgcacggcatgcgagcgcgccaagcgtaccctgtcctcctccacgcaggcc
agcatcgagatcgactcgttgtacgagggaattgacttctacacctccatcacccgagcg
cgcttcgaggagctctgcgccgacctcttccgcggcactctcgagcccgtcgagaagtcg
ttgcgcgacgccaagatggacaaggcccagatccacgacatcgtcctggtcggcggctcc
acgcgtatccccaagatccagaagctcctgcaggacttcttcaacggcaaggagctcaac
aagtcgatcaatcccgacgaggctgtggcgtacggggcggccgtacaggcggctatcttg
cacggcgacaaatccgaggaggtgcaagacttgcttctgctcgacgtcacgccgctctct
ctgggtatcgagacggccggcggtgtcatgaccgcgctcatcaagaggaacaccaccatc
ccgacgaagcagacccagaccttcacgacctacgccgacaatcagcccggcgtgttgatt
caggtgtacgagggcgagcgcgccatgaccaaggacaacaacctgctgggcaaattcgag
ctcagcggcatcccgccagcaccgcgcggggttcctcagatcgaggtcacgttcgacatc
gacgcgaacggtatcctcaacgtctccgccgtggacaagtccaccggcaaggagaacaag
atcaccatcaccaacgacaagggccgactcagcaaggaggacatcgagaggatggtgaac
gaggcggagaaataccgcagcgaggacgagaagcagaaggagacgatcgcggccaagaac
ggcctcgagtcctactgcttcaacatgaagagcacggtcgaggacgagaagctcaaggac
aagatcagcgcgtcggacaagcagacgatcctggacaagtgcaacgacatcatcaagtgg
ctcgacgcgaaccagctggccgacaaggaggagtacgagcacaagcagaaggagctcgag
ggcatctgcaaccccatcgttacgaagctctaccagggtgccggcggtatgcccggtggc
atgccaggtggtttccctggagcgggcggcgctgctcccggcggagcgcctagcggcggc
ggcgccgcgtctggacccaccatcgaggaagtcgactaa

DBGET integrated database retrieval system