KEGG   Vollenhovia emeryi: 105561842Help
Entry
105561842         CDS       T06016                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 1-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
vem  Vollenhovia emeryi
Pathway
vem00430  Taurine and hypotaurine metabolism
vem00480  Glutathione metabolism
vem00590  Arachidonic acid metabolism
vem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105561842
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    105561842
   00480 Glutathione metabolism
    105561842
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vem01002]
    105561842
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:vem04090]
    105561842
Enzymes [BR:vem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     105561842
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     105561842
    3.4.19.14  leukotriene-C4 hydrolase
     105561842
Peptidases and inhibitors [BR:vem01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   105561842
CD molecules [BR:vem04090]
 Proteins
  105561842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 105561842
NCBI-ProteinID: XP_011867582
Position
Unknown
AA seq 579 aa AA seqDB search
MIGVRKKLLVAGVATVILVAVFVVLIVVFTLNSGDVKCGPKFVSSSKLGRYTKGAVTTNG
QECSKIGADILFRNGSAVDAAIAALLCESVASLHSMGLGGGFFMTIWDAKSKTADFLDAR
ETAPLAATEKMYDGNARLSMYGGLAVAVPGELMGYSEAHKKYGRLPWPELFEPAIKLCET
GSRVNDYLASYLAEKEPMIKNESSMAEILINPDTNRTWIAGDRIKRPKLAKTLRLIADEG
VDVFYNGIIADKLVDEIARFKGIITKRDFQEYRAIWRKPVSLKMGNLTLYSAPPPGSGAI
LTFIMNVLRRLLPVSNENVMWQRVVETFKWAYARRTELGDPDFVEGIDALLANLTSNDYA
EMIKGRIKDDRTSQDPADYGAVTATIVDAGTAHVSVLAPDGSAVSVTSTINQVLGAMIRS
VSTDIIFNDEMDDFSSPNITNGFGLPPSPANFIRPGKRPLSSMCPAIVVDHKDNVRLVIG
AAGGSKITSAVAIGMLLNLWFDYDIKEAVDARRLHHQLLPMIVENEKNFCQATLNYLSKI
GHNITTFSGIGSAITAISTKNGLVTANSDFRRQGTTAGL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagtgcggaaaaagctgcttgtggctggcgtcgcgaccgtcatacttgtggct
gtctttgtggtattaatcgtagtcttcacgctcaattcaggcgacgtaaaatgcggtcca
aagttcgtcagttcttccaaactgggtcgatacacaaagggcgccgtgacgacaaacggc
caggaatgctccaaaatcggcgccgatatcttattcaggaacggctcggcggtggatgcg
gcgatagcggcgcttctttgcgaaagtgtcgcgtccctgcacagcatgggactgggcggc
ggatttttcatgacgatatgggacgcgaaaagcaaaaccgcggattttctggacgcgagg
gagaccgccccgttggccgcgacggagaaaatgtacgatggcaacgctcgtttatccatg
tacggtggcctggcagttgcggtacccggcgagcttatgggctattcggaagcgcataaa
aaatacgggagattaccgtggccggagttatttgagcccgccattaaattgtgcgaaact
ggatcgcgcgtcaatgattatctcgcctcgtatctggccgagaaggagcctatgataaag
aacgagagcagtatggctgaaatactcataaatcctgacaccaatagaacgtggatcgcg
ggtgaccgaataaagaggccgaaactcgccaagacactgaggctgatagcggacgagggt
gtcgacgtattttataatggtattatcgcggacaaattagtcgacgagatagcgaggttt
aagggaataatcacgaagcgagattttcaagagtatagggccatatggagaaagccggtc
tcattgaaaatgggaaacctgacgctttacagcgccccgccgcctggttcgggcgcgatt
ctgacgtttataatgaacgtccttcgtcgtttgctgccggtcagcaatgagaacgttatg
tggcaacgggtagtggagaccttcaagtgggcttacgcaaggagaacggagctgggggat
cctgattttgtcgaaggcatagacgcgctgctcgccaatttaacgtccaacgattacgcg
gaaatgataaaagggaggattaaggacgatcgcacgagtcaagatccggcggattacggc
gccgtcaccgcaacaatcgtggatgcggggaccgcgcacgtttccgtcctcgctcctgat
ggctccgccgtttccgtcacatcgaccatcaatcaggtgctcggcgcgatgatacgctcc
gtgtccaccgatataatatttaacgacgagatggacgacttcagctcgcccaacatcacc
aacggcttcgggctgccgccgtcaccggcgaacttcattcggcctggcaaacggccgctg
agttcgatgtgtccggctatagtggtcgatcacaaggacaatgtgagattagtgattggt
gcagccggtggttccaagatcacgagcgccgtggcgattgggatgctcttgaatctctgg
tttgattacgacataaaggaagcggttgatgcgcgtagacttcatcatcaactgctgccg
atgattgtcgagaacgagaaaaacttttgccaagccacgttaaattacttgagtaaaatc
gggcacaacatcaccacttttagcggaattggaagcgcaattacggcaatatccacgaag
aatggactcgtaacagcaaactcagattttcgccgacaggggacaacagcgggattataa

DBGET integrated database retrieval system