KEGG   Vollenhovia emeryi: 105562490Help
Entry
105562490         CDS       T06016                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
vem  Vollenhovia emeryi
Pathway
vem00061  Fatty acid biosynthesis
vem01100  Metabolic pathways
vem01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105562490
Enzymes [BR:vem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     105562490
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     105562490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind NmrA 3Beta_HSD Polysacc_synt_2 Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 105562490
NCBI-ProteinID: XP_011868760
Position
Unknown
AA seq 249 aa AA seqDB search
MSKLIAGKLALVTGAGSGIGREVCRVFAREGAKVVAIDQNVKTATETVAVLEGAGHVALN
VNVADRKSVETAFEHVLKQFSRPPTIIVNSAGITRDNFLVKLSDIDFDDVINVNLKGTFL
VMQTAVKEMISANATENSSIINISSITGKRGNIGQSNYSASKAGVIAMTSTASMEFGQFG
IRVNAILPGVIDTPIIATLPDKVKEFFIKNIPLQRIGRPQEVAEVTAFLASDKSSYITGA
SIEVTGGLH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagctaatagctggaaaattggcgttagttactggtgcaggaagcggcatcgga
agggaggtatgtcgagtttttgcccgagaaggtgctaaagttgttgcaatcgaccaaaac
gtcaaaactgctacggaaactgtagctgttttggaaggtgctggacatgttgcattgaac
gttaacgtcgctgatcggaagagcgttgagacagcgtttgaacatgtcttaaagcagttt
tcaagaccaccaaccatcattgttaattcggcaggcattacacgggataactttttagtg
aaacttagcgacattgattttgacgatgtaatcaatgtcaatttaaaaggcactttccta
gttatgcaaactgctgttaaagaaatgatatcggcaaatgcaaccgaaaactcgtcgatt
atcaacattagttcaataactggtaaacgtgggaatatcgggcaaagcaactacagcgca
tcaaaagctggagtgatagctatgacaagtaccgcctccatggagtttggacagtttgga
attcgcgtgaacgcaatactgcctggtgttatagacactcctattatcgcaactttacct
gataaagttaaagagttttttataaaaaatataccattgcaaagaataggaagaccgcaa
gaagtggcagaagttactgcatttttagcttctgataagagttcttatataactggagca
tctattgaagttacggggggattacattga

DBGET integrated database retrieval system