KEGG   Vollenhovia emeryi: 105563295Help
Entry
105563295         CDS       T06016                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
vem  Vollenhovia emeryi
Brite
KEGG Orthology (KO) [BR:vem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vem01001]
    105563295
Enzymes [BR:vem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105563295
Protein kinases [BR:vem01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   105563295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Dehydratase_MU
Motif
Other DBs
NCBI-GeneID: 105563295
NCBI-ProteinID: XP_011870157
Position
Unknown
AA seq 444 aa AA seqDB search
MLLSLRRDRGGILAVQKSTPMPKSATKWRFWRKSKRAVLEENDQESRRKRSAPPPVVVTQ
VIKQDYDQIPEAKVPEAEDTRRKTMENPLNSRLSPKVTPITEDYEISNHVLGLGINGKVV
QCYSRNTRQKYALKVLHDCAKARREVELHWRASNCRHIVQVKDVYENSYSGNKCLLVVME
CMEGGELFQRIQDRQDGAFTEREAAQVMFEICVAVKHLHDMNITHRDLKPENLLYSKPDI
TGTLKLTDFGFAKETHLKDTLQTPCYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCG
FPPFYSNHGLAISPGMKKRIRLGQYDFPSPEWANVSQEAKNLIKGMLCIDPAERLQIDAV
MRNNWIAKYMEVPATPLHTGRVLREGEEMWPEVQEEMTRSLATMRVDYDTACLKQLDHTN
NPLLNKRRRAKQSANNATVPTPAS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgtctctccgacgggatcggggcggaatcttagccgtgcaaaaatcgacaccg
atgccgaagtcggcgactaagtggagattctggagaaagtccaagagggctgttctcgag
gagaacgatcaggagagccggcgcaagcgctcggcaccgccgccggtggtcgtgacgcag
gtcatcaaacaggactacgatcagataccggaagcgaaggtaccggaagccgaggacacc
cggagaaagacgatggagaatccgctcaacagccggctgtcgcccaaagtcacgccgatc
acagaagactacgagatcagtaatcacgtgctgggcctcgggatcaacgggaaggtcgtg
cagtgctacagcaggaatacgaggcagaagtacgctcttaaggtcctgcatgactgcgca
aaagcgcggagagaggtcgagcttcattggagagcgtcaaattgcaggcacatagtccaa
gtcaaggatgtgtatgaaaattcctatagcgggaacaaatgtctgctggtagttatggaa
tgcatggaaggcggagagctgtttcaaaggatacaagataggcaagacggcgcttttacc
gaaagagaggcggcgcaagtgatgttcgagatctgtgtcgcggtgaagcatctacacgac
atgaacatcactcacagggatctaaaacctgagaatcttttatattccaaacctgacatc
actggaaccctgaaactcaccgactttggatttgcgaaagaaacacatttaaaagacacg
ttacagacaccatgttacacaccgtactacgtcgctccggaagttttggggccagaaaag
tacgacaagagctgtgatatttggtcattgggagtaattatgtacatattattgtgcggc
tttccaccattctacagcaatcacggattagcgatctcgcccggaatgaaaaagaggatc
cgactgggacagtacgactttccctctccggaatgggcgaacgtgagccaggaagctaag
aacctcatcaagggtatgctgtgtatagatccagcggaaaggcttcagatcgacgctgtg
atgcgcaacaactggattgccaaatatatggaggtacccgctactcccttacacaccgga
cgcgttctgcgcgagggagaggaaatgtggccggaagtgcaagaggagatgacgcgatcg
ctggcgacaatgcgcgtcgactacgacacggcgtgtctgaagcagctcgatcacacgaac
aatcccttgttgaataagcgaaggcgcgcgaaacagtccgcgaacaacgcgacggtccct
acgcctgcctcctag

DBGET integrated database retrieval system