KEGG   Vollenhovia emeryi: 105567598Help
Entry
105567598         CDS       T06016                                 

Definition
(RefSeq) insulin-degrading enzyme isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
vem  Vollenhovia emeryi
Brite
KEGG Orthology (KO) [BR:vem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vem01002]
    105567598
Enzymes [BR:vem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     105567598
Peptidases and inhibitors [BR:vem01002]
 Metallo peptidases
  Family M16: pitrilysin family
   105567598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 105567598
NCBI-ProteinID: XP_011877956
Position
Unknown
AA seq 1018 aa AA seqDB search
MFATRALKSRVSLVAARSRLLFRNNISEPVTLASNMSTHRSSSHKRVEERYDDIIKSQND
DRLYRGLVLANKMKVLLISDSTTDKSAVAMDVNIGYMCDPDDLPGLAHFCEHMLFLGTEK
YPQQNDYTMYLSQNGGGSNAATYSDHTTYYFDITPEKLEGGLDRFSQFFKAPLFTEALTE
LELNAINSEHEKNVANDTWRCDQVDKSSASPDHPFSKFGTGNRETLDTIPKQQGINVRNR
LLEFHEKYYSANVMSLCILGKESLDELENMVLDLFSEIKNKEINVPIWPEHPFKDEHFRT
IWYIVPIKDTRNLDITFPLPDMQKHYRSSPANYVSHLLGHEGEGSLLSALKARSWCNSLV
SWKRPSSRGFEFFSVVVDLTEEGIKHIEDIVQLMFQYINMLKRKDPIKWIYDEYKDIANI
NFRFKEKFPPRCYVTCIVQMLQEYPMNDVLCAQTVFPEWRPDLIEEIMKYLVPENIRIHV
VAKAYENIADETEKWYGTKYKKVKISKETMDMWKHAGYNNDLRLPSKNEFIASTFDIKPH
TTVEKFPIILEDTSLVRLWYKKDDEFIVPRAKMIFDFVSPYAYMDPLSCNLTNMFVQLFR
DSLNEYAYDAELAGLQWELNNSKYGIALGISGYDDKQRVFLEKIMDRMINFKIDPKRFEI
LKENYIRNLKNFAAEQPYQHAMYYIAVLLTEQAWLKDELLDHTPYLSVDRLQYFIRRLLS
KLHVECLIHGNVTVTEATDILKLIESKLTTGIPHIESLVQKQLVLYREIKLDHGCHFLFE
AENKWHKSSCTTVYHPTGLQSTETNMLLELLAQIIAEPCFNILRTKEQLGYIVLSGIRRA
SGTQGLRIVVQSDKHPQYVEKRIDSFLDSMLEHISTMPEEQFEEHKKALATIRLEKPKML
SSRSTLYWNEIVSQQYNFDRVNIEVAYLKTITQEQLFNFYEENVHNKGRRKLSVHVISTT
TDNNLLDDTSRKIADLSIDEDVKKINDIVSFKKSQHLYPLLKPYEKYFLTKGIRSSKL
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccacccgcgcgttaaaatcccgcgtgtcgctcgtagccgcacgctcccgcctg
ctcttcaggaataatatttccgagcccgtgactttggcgagcaacatgtcgactcatcga
tcgagttcccacaaacgtgtggaagagcgatacgacgatataataaaatcgcaaaatgac
gaccgattgtacagaggtttagtgcttgctaataaaatgaaggttcttttaataagtgac
tcaacaacggacaagagtgctgtcgcaatggacgttaatatcggctatatgtgcgatcca
gacgatctaccgggactagcacacttctgcgagcatatgttgttcttgggaacggagaaa
tatcctcagcagaatgattacactatgtatttgtcgcagaatggcggcgggagcaacgca
gctacgtactcggatcacaccacctattacttcgatataacaccggagaagttggaaggc
ggtttagatcgtttttcgcagttttttaaagcgcctctctttacggaggccttgaccgaa
ctggagctaaatgctataaattcagaacatgagaaaaatgtagcgaacgacacctggcga
tgtgatcaagtggacaaatcgtctgcaagcccggatcatccgttttccaaattcggcacc
ggcaatagagaaacattagacacaataccgaaacaacagggcattaacgttagaaatagg
ctactagaatttcatgaaaagtattattctgcgaatgttatgtcattatgtattctcggc
aaagagagtttggatgagctcgaaaacatggtattagatctctttagtgaaataaaaaac
aaggaaattaatgttccaatatggcctgagcatccattcaaggatgaacactttcgcacg
atatggtatattgttccgataaaagacacaagaaatttagatattacgtttcctttacct
gacatgcagaaacattaccgatcttcgcctgcgaattacgtttcccatttacttggacat
gaaggagagggttcattattatcggctttaaaagctaggagttggtgtaattccctggta
tcttggaaacgccctagcagccgaggtttcgaattcttcagtgttgttgtagatctaact
gaagaaggtattaagcatatagaagatattgttcaactgatgtttcagtatatcaatatg
ctcaagagaaaagacccgatcaaatggatctatgatgaatacaaagatattgcgaatata
aatttccgttttaaggaaaagtttccgccacgttgttacgtgacttgtatagtccaaatg
ctacaagaatatcccatgaacgatgttttgtgcgcgcaaaccgtttttcctgaatggcgg
ccggacttgatcgaggaaataatgaaatatttggtgccggagaatatcaggattcatgtg
gtcgcaaaagcatatgaaaatatagcagatgagaccgaaaagtggtatggcactaaatat
aagaaagtgaagatatccaaggaaacaatggacatgtggaaacacgctggttataataat
gacctgagattgccttctaagaatgaatttatagcctctacatttgatatcaagccacac
actacggtagaaaaattccctattattttggaggatacatcattggtaagactgtggtat
aaaaaggacgatgaatttattgtaccgagagcaaagatgatctttgattttgttagtcca
tacgcctatatggatcctcttagttgcaatttgactaatatgtttgttcagctatttcgt
gattctcttaacgaatacgcatatgatgctgagctagctggtttacaatgggaacttaat
aattcgaaatatggaatagcacttggtataagtggttacgatgacaaacaacgtgtgttc
ctggaaaaaattatggatcgaatgataaatttcaagattgatccaaagagatttgaaatc
ctaaaggaaaattacatcaggaacttgaaaaattttgctgctgaacaaccttatcagcat
gcaatgtattatattgcagtcttgttgacggaacaagcttggctcaaggatgaattgttg
gatcatactccttatctaagtgttgatagactccagtacttcatacgacgtcttctcagt
aaactgcatgtggaatgtttgatacatggtaacgtgactgtaacggaagctacagatata
cttaaactaattgagtctaagttgacaactggaatacctcacatagaatccttggtacaa
aagcagttagtgttatatcgggaaattaaactagatcatggttgccacttcctatttgaa
gcagaaaataaatggcataagagttcttgtacaacggtgtaccatccaactggtttacaa
tcaacggagacaaatatgctcttagagctgttagcacaaattattgcggaaccttgcttc
aatattttgagaactaaggagcaattaggctatatagtacttagcggtatacgtcgagca
agcggaacgcaaggtttgagaatcgtagtacaaagtgacaaacacccgcaatatgtggaa
aaacgaatcgattcatttctagattctatgttggaacatatatctactatgccagaagag
caatttgaggaacacaagaaagctctggctacaatacgtttggagaaacccaaaatgtta
agttcacggagcactttatattggaatgagattgtaagccaacaatataacttcgatcga
gtaaatattgaagtagcttacttaaagacgataacgcaggagcaattatttaacttttat
gaggaaaatgtacataataaaggtcgacgtaaattgtcagtacatgtgatatccacaaca
acggataacaatttacttgatgacacgtcaaggaaaattgctgacttatcgattgatgaa
gacgttaagaaaatcaatgacattgtgtcatttaaaaagagtcaacatttatatcctcta
ctaaaaccatatgaaaaatattttctcacaaaaggcatacgatcttctaagttataa

DBGET integrated database retrieval system