KEGG   Vibrio antiquarius: VEA_000024
Entry
VEA_000024        CDS       T01107                                 

Definition
(GenBank) uncharacterized protein ImpF
  KO
K11897  type VI secretion system protein ImpF
Organism
vex  Vibrio antiquarius
Brite
KEGG Orthology (KO) [BR:vex00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vex02044]
    VEA_000024
Secretion system [BR:vex02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VEA_000024
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACY52711
Position
2:24023..24487
AA seq 154 aa
MSLTVSLLDKLMDSDPSTRDEKDFPTSQQQMLNSLLRDLESMLNSRIGWKNIPDDLLEVR
YSILNYGLPDFSSMPYSSQEGQNQLCDIVHDAIKEFEPRLRNPYVQISDEKNAIDRVLRL
QISATCLIDNSIHEVRFNSEVEPVNLGMKLSRAK
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtctttaaccgtttctctgctcgacaaattgatggatagtgatccttcaactagagat
gaaaaagacttccctacgagccaacaacagatgttgaacagcttgcttagagatctggag
tctatgttaaatagtcgtatcggatggaaaaacattcctgatgaccttttagaggttcgc
tattcaatattgaattatggtctgccagatttttcctcgatgccttatagcagccaagag
gggcagaatcagctttgtgacattgttcatgatgcaattaaagagttcgagcctaggtta
aggaatccttatgtccagatttcggacgagaaaaacgctattgatagggtgttgaggtta
caaattagcgccacttgcttaatcgataacagcattcatgaagtgcgattcaattctgaa
gtagagccggtaaatttaggtatgaaactgagtagagcgaaatga

DBGET integrated database retrieval system