KEGG   Vibrio antiquarius: VEA_000028
Entry
VEA_000028        CDS       T01107                                 

Definition
(GenBank) hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vex  Vibrio antiquarius
Pathway
vex03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vex00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VEA_000028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vex02044]
    VEA_000028
Secretion system [BR:vex02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VEA_000028
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACY52715
Position
2:30056..30535
AA seq 159 aa
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTI
TKLQDRSSPDLFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPV
ETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcagtctaatacgtatcttaaatacgcagatattaagggtgaggcaactgccgagcaa
tataaagatttgattacactactatctgtagattggagtgtaggtcgtgagatctcatca
tacactggtacagcgatggaccgtgaagcgagcgctactcgtctatatgatttgactatc
actaaacttcaagaccgttcttctcctgacttatttaaagaagcgacaattggtaaaggt
aaacctgcggttttccatattactaagcagggtgagaaagttgaagaaatcatgaagatc
gaactgactgatgcgatgatttctaactactcagtttctatccaggatgatcgtccagtt
gaaaccatcactatttcttacactgaaatgatgatgacagtgactcctactgacgataaa
aacaacacttctgcgccattggtatacggctacagcggtgttaaaggtcaacaaatgtaa

DBGET integrated database retrieval system