KEGG   Vibrio antiquarius: VEA_000046Help
Entry
VEA_000046        CDS       T01107                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vex  Vibrio antiquarius
Pathway
vex00260  Glycine, serine and threonine metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VEA_000046
Enzymes [BR:vex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VEA_000046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACY52734
Position
2:complement(49977..50981)
Genome map
AA seq 334 aa AA seqDB search
MDFRSDTVTQPTQAMREAMFKAPVGDDVYGDDPTVNELEEFAAELAGFEAALFTTSGTQA
NLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPVENNPDGTLPFDKLAAAIK
PDDCHFARTKLLSLENTINGKVLPLSYLAEARDFVNKHNLQMHLDGARVFNAAAALDVPV
KEIGQYFDSMTICLSKGLTAPVGSLLLGSKEYIAKARRLRKMVGGGMRQAGILAAAGKLA
LTEQVEQLKQDHINAKTLAEGLAELPGFSVNPEFVQTNIVFAKLDPQVDIVNIAAKLKEQ
NITITPGNPIRFVTHKDISAQDIDNFLSSIKSLL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgatcagataccgttacacagcctacccaagccatgcgagaggccatgttt
aaggcccccgttggggatgatgtttatggtgatgaccctacggtcaatgagcttgaggag
tttgccgcagagcttgcaggattcgaagcggctttgtttaccacttcaggcacgcaagcc
aatctgctcggcctaatggcgcattgtgaacgcggagatgaatatctatgtgggcagcaa
gcacataactacaagtacgaagctggcggcgcagcagtacttgggtcaattcaacctcaa
ccagtcgaaaataacccagatggcacactcccatttgataaactggcagcggcgattaag
ccagatgattgtcactttgctcgtaccaagctgctcagcttagaaaatacgattaatggt
aaagtattacctctgtcttatttagcagaagcacgtgacttcgtgaataaacataacttg
cagatgcatctagatggcgctcgcgtttttaatgcagccgctgcgcttgatgttccggta
aaagaaatcggtcagtattttgattcaatgacgatttgtctgtcgaaaggtttgactgcc
cctgttggttcgttactgcttggtagcaaagagtacatcgcaaaagcacgtcgcttaaga
aagatggtcggcggtggtatgcgtcaagcgggtattcttgccgcagcaggcaaactcgcc
cttaccgaacaagtggaacagctaaaacaagatcatatcaacgcaaaaaccttagcggaa
ggtttagctgaactgcctggtttttcagtcaaccctgaatttgttcaaacgaatatcgta
ttcgcgaagcttgatcctcaagtggacatagtaaatatcgctgcgaaactaaaggaacaa
aatatcacgataacacctggaaaccccattcgtttcgtgactcataaagacatttcagcg
caagatatcgacaatttcttatcaagcattaaatctctgctttag

DBGET integrated database retrieval system