KEGG   Vibrio antiquarius: VEA_000375Help
Entry
VEA_000375        CDS       T01107                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase (isoleucine degradation)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vex  Vibrio antiquarius
Pathway
vex00071  Fatty acid degradation
vex00072  Synthesis and degradation of ketone bodies
vex00280  Valine, leucine and isoleucine degradation
vex00310  Lysine degradation
vex00362  Benzoate degradation
vex00380  Tryptophan metabolism
vex00620  Pyruvate metabolism
vex00630  Glyoxylate and dicarboxylate metabolism
vex00640  Propanoate metabolism
vex00650  Butanoate metabolism
vex00900  Terpenoid backbone biosynthesis
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
vex01212  Fatty acid metabolism
vex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEA_000375
   00630 Glyoxylate and dicarboxylate metabolism
    VEA_000375
   00640 Propanoate metabolism
    VEA_000375
   00650 Butanoate metabolism
    VEA_000375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VEA_000375
   00072 Synthesis and degradation of ketone bodies
    VEA_000375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEA_000375
   00310 Lysine degradation
    VEA_000375
   00380 Tryptophan metabolism
    VEA_000375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VEA_000375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VEA_000375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VEA_000375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vex04147]
    VEA_000375
Enzymes [BR:vex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VEA_000375
Exosome [BR:vex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VEA_000375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt PDT
Motif
Other DBs
NCBI-ProteinID: ACY53063
Position
2:complement(425292..426470)
Genome map
AA seq 392 aa AA seqDB search
MKNETWIVAAKRTPIGSFQGALASTDVTELGAKAIQGALAESQLDVQKIDEVLMGCVLPA
GVGQAPARQASLKAEMPQSIGCTTLNKVCGSGMKTVMLAHDLIQSGNAHAVIAGGMENMS
SSPYLLKKARDGFRLGHEQVLDHMFYDGLQDAYQGELMGVFAEQTAQKYQFSRESMDIWA
QQSLTRAQQAIEQGLFKEEIVPVNVKSRRDETLVVDDEQPSKLDVTKIPTLRPAFAKDGG
VTAANSSSISDGASAMILVDSEFGRQENLQPLAKIVAYSTHARQPDEFTIAPVFAIESLL
EKTGWDKSDVDLWEINEAFAVVTQYAVKALELNESKVNPRGGACALGHPIGASGNRILVT
LIHALKQTGGKRGVASLCIGGGEATAIAIEIC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaacatggattgttgccgccaagcgaacgcctatcggctcttttcaaggt
gcattagcttcaacagatgtcacagaactcggtgcgaaagccatccaaggggcactagcc
gaaagccaactcgatgtgcaaaaaatagacgaagtgttgatgggatgcgttttacccgcc
ggcgtggggcaagcgccagcaagacaagcaagtcttaaagcagaaatgccacaatcgatc
ggttgtacgacactgaataaagtctgtggttcgggtatgaaaaccgtcatgctggcacat
gatcttattcaatctggtaacgcgcacgcggttatcgctggcggtatggaaaacatgtcc
tcttctccttatctacttaagaaagcgcgtgatggtttccgcttaggccatgagcaagtg
cttgatcatatgttttatgacggtttgcaggatgcctaccaaggcgaattgatgggtgtc
tttgccgaacaaaccgcgcaaaagtatcaattcagccgtgaaagtatggatatctgggcg
cagcagtcgttgactcgcgcgcagcaagcgattgagcaaggtttgttcaaagaagagatc
gtgcctgttaacgtaaaaagtcgacgcgacgaaaccttggtggtagacgatgagcaaccg
agcaaactcgacgtcactaaaattcctaccttacgccctgcgtttgccaaagatggcggc
gtaaccgcagcaaactctagttccatttcggatggtgcgtcggcaatgatcttagtcgat
agtgagtttggtcgtcaggaaaaccttcagcctctagccaaaattgtcgcgtacagcacg
catgcaagacagcctgatgagttcaccatcgcaccagtcttcgcgattgaatcgctgctg
gaaaaaacgggctgggacaaatcagacgtggacctttgggaaatcaatgaagcttttgct
gtcgtgactcaatacgcggtgaaagctctcgaactgaacgagagcaaagtgaaccctcgc
ggaggggcttgtgcgctggggcatccaataggcgcaagtggcaatcgaatccttgtcact
ttgattcatgcgctaaaacaaactggtggtaagcgtggcgttgcatcgctttgtattggc
ggcggcgaagctaccgctatcgcgattgaaatctgctaa

DBGET integrated database retrieval system