KEGG   Vibrio antiquarius: VEA_000441
Entry
VEA_000441        CDS       T01107                                 

Definition
(GenBank) uncharacterized protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
vex  Vibrio antiquarius
Brite
KEGG Orthology (KO) [BR:vex00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vex02044]
    VEA_000441
Secretion system [BR:vex02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VEA_000441
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACY53129
Position
2:complement(503374..503880)
AA seq 168 aa
MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARADETPIEERTPINIDKD
NFNEVLEGMSPNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELR
EALVALKGPLGNVPAFRKKIASVLQDEDARKKLLDELSIGNDQEAKEE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcacgtgacggctcggtggctcctaaagagcgaattaatatccgttatgttccagca
actggcgatacgcaagaagacgtagaactgccgctaagcatgatggtggttggcgacttt
actgcacgtgcagatgagacgccaattgaagaacgcactccaatcaatatcgataaagac
aactttaacgaagtgctagaaggcatgtctccaaacgttaaagtgaacgttgaaaaccgt
ctttctgatgaagaaggcggccaaatcggtgttgatctaacgttccaaaacatgaaggac
ttctctccagaagcgattgcgaaaagcgtgcctgaactaaacagcctgcttgaacttcgc
gaagccttggtggcgctgaaaggccctctaggtaatgttcctgcattccgcaagaagatc
gcatcggttcttcaagatgaagacgcgagaaagaaactgttggatgaactaagcattggt
aacgaccaagaagcaaaagaagagtaa

DBGET integrated database retrieval system