KEGG   Vibrio antiquarius: VEA_002199Help
Entry
VEA_002199        CDS       T01107                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vex  Vibrio antiquarius
Pathway
vex00010  Glycolysis / Gluconeogenesis
vex00620  Pyruvate metabolism
vex00640  Propanoate metabolism
vex00680  Methane metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_002199
   00620 Pyruvate metabolism
    VEA_002199
   00640 Propanoate metabolism
    VEA_002199
  Energy metabolism
   00680 Methane metabolism
    VEA_002199
Enzymes [BR:vex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VEA_002199
Lipid biosynthesis proteins [BR:vex01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VEA_002199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACY50362
Position
1:complement(640734..642686)
Genome map
AA seq 650 aa AA seqDB search
MSEAHVYPVKENIKTHTHADNDTYLAMYQQSVTDPEGFWNEHGKIVDWIKPFTKVKSTSF
DTGHVDIRWFEDGTLNVSANCIDRHLAEHGDDVAIIWEGDDPADDKTLTFNELHKEVCKF
SNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTVVFGGFSPEALSGRIIDSDA
KVVITADEGVRGGRAVPLKKNVDEALTNPDVKTINKVLVLKRTGGDVEWHEHRDVWWHEA
TANVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYVFDYQPGET
FWCTADVGWITGHTYLIYGPLANGAKTILFEGVPNYPSTSRMSEVVDKHQVNILYTAPTA
IRALMAKGDEAVAGTSRSSLRIMGSVGEPINPEAWEWYYKTIGNENSPIVDTWWQTETGG
ILIAPLPGATDLKPGSATRPFFGVQPALVDNMGNILEDTVAEGNLVILDSWPGQMRTVYG
DHERFEQTYFSTFKGMYFTSDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVAH
HKIAEAAIVGIPHDIKGQAIYAYITLNDGEFPSAELHKEVKDWVRKEIGPIATPDVLHWT
DSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVDKLIAEKAELA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcccacgtttatccggtaaaagaaaatattaaaactcatacacacgcggat
aatgatacttacttagccatgtatcagcagtcggtaaccgatccagagggcttctggaac
gagcacggcaaaatcgttgattggatcaaacctttcaccaaagtaaaaagcacttctttc
gacactggccatgttgatattcgctggtttgaagatggcacactgaacgtctcggctaac
tgtattgaccgtcatctcgcagaacacggggacgacgtcgccatcatttgggaaggcgat
gatccagccgacgacaaaacactcactttcaacgaactacacaaagaagtgtgtaagttc
tccaacgcattgaaagagcaaggcgtacgcaagggcgacgtggtgtgtctatacatgcca
atggtgccagaagccgcagtggctatgctcgcttgtacccgtattggtgcggttcacacc
gtagtatttggcggtttctcaccagaagcactctctggccgtatcatcgactctgacgcg
aaagtcgtgatcaccgctgatgaaggcgtacgcggcgggcgtgccgttcctctgaaaaag
aacgtggacgaagcactaactaacccagacgtaaaaaccatcaataaagtgttggtgctt
aaacgcacaggtggtgatgtcgaatggcatgaacaccgtgatgtttggtggcacgaagca
acagctaacgtttctgacgtttgcccaccagaagagatgaaagccgaagatccgctcttc
atcctttacacttcaggttcaacaggcaaacctaaaggtgtactacacacgaccggtggt
tacctcgtctacgcggcgatgacctttaaatatgtcttcgattatcaaccaggtgaaacc
ttctggtgtaccgcggatgtgggttggattaccggtcacacttacctaatctacggtcca
cttgcaaatggggcgaagaccatcttattcgaaggtgtaccaaactacccaagcacaagc
cgaatgagtgaagtggttgataaacaccaagtcaacattctatacaccgccccaaccgcg
attcgtgcgctaatggcaaaaggtgatgaagcggttgcaggcacatctcgttcaagcctg
cgcatcatgggctcagtgggcgaaccaatcaacccagaggcgtgggagtggtactacaaa
acgattggtaacgagaactcacctatcgtcgatacttggtggcaaacggaaactggcggc
atcttgattgcgccactaccaggggcaaccgatctaaaaccaggctctgcgactcgccca
ttcttcggcgtccagcctgctcttgtcgataatatgggcaacattcttgaagataccgtt
gctgaaggtaacttggttatccttgattcttggccaggccagatgcgcacggtttacggc
gaccatgagcgctttgaacagacctacttctcaacctttaaggggatgtacttcaccagt
gatggtgcgcgtcgtgacgaagacggctactactggatcacaggccgtgttgatgacgta
ctaaacgtgtcgggtcaccgtatgggtaccgctgaaattgaatcagcgctagtggcgcac
cacaagattgcagaagcggcgattgttggtattccacatgacatcaaaggccaagctatc
tacgcttacattacattgaacgatggtgaattcccgtcagctgagctgcacaaagaagtt
aaagattgggtgcgtaaagagattggtccaatcgcgacaccagatgtactgcactggacg
gattccttaccgaagactcgctctggtaagataatgcgtcgaatcctgcgtaagattgca
acgggcgatacaagcaacctcggagacacgtcaacgcttgccgatccgagcgtggtagac
aaactcatcgcagagaaagcagaattggcataa

DBGET integrated database retrieval system