KEGG   Vibrio antiquarius: VEA_002502Help
Entry
VEA_002502        CDS       T01107                                 

Definition
(GenBank) BarA sensory histidine kinase
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
vex  Vibrio antiquarius
Pathway
vex02020  Two-component system
vex05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VEA_002502
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VEA_002502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vex01001]
    VEA_002502
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vex02022]
    VEA_002502
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VEA_002502
Protein kinases [BR:vex01001]
 Histidine kinases
  NarL family
   VEA_002502
Two-component system [BR:vex02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   VEA_002502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2222 Response_reg HATPase_c HisKA Hpt HAMP HATPase_c_3 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: ACY50664
Position
1:complement(981878..984676)
Genome map
AA seq 932 aa AA seqDB search
MTRYGLRARVITLTLAPTLIIGLLLSGFFSFNRYQDLEKQVITTGNSIIEPLAIASETHL
LSESREAVRRLISYAHRKNSKLVRSIAVFDEHHELFVTSNFHPNFEALMFPKDKPIPQLG
NSEIYENSLILRVPILSEGHYLAELSNESQGTKAIGYIAVELDLSSLRLQQYQEVFSAFL
VLILGLGLASVFASRLMHDVTQPITHMKNVVDRIRRGHLDVRIEGKMHGELDQLKNGINA
MAVSLSEYHVEMQHSIDQATSDLRETLEQLEIQNVELDIAKKRAQEAARVKSEFLANMSH
ELRTPLNGVIGFTRQMLKTQLSNSQTDYLQTIEKSANNLLNIINDILDFSKLEAGKLALE
NIPFDFRESLEEVINLQATSAHEKGLEITLKVDPKIPPGLVGDPLRIQQILTNLVGNSIK
FTERGNIDVSVEMRSQSGDSVELQFMVRDTGIGISERQQAQLFQAFSQADASISRRYGGT
GLGLVITQKLVSQMGGEISLTSRLHQGSTFWFTVRLHSTEMPMSELIEVELLTGKQLLLI
EPNMQAASVTQQILSQEGILVTYRSSLPKNEEQYDYVLLNLAANQTHDADVITPWIEQAK
RMAPSVILGTPSTELALADQIMTEHHVQCLTKPLSRRKLLQSLISEHVESPPTLSAPITP
SEGERLPLTVLAVDDNPANLKLISALLRERVETVTACSNGQQAVNLATEKKYDLIFMDIQ
MPQMDGVTACQHIKELELNKDTPVIAVTAHAMAGERDRLLSAGMDDYLTKPIEEHVLQQV
LVHWNPNACTESIGKVAPSYVDEPEGSAPQSVSSPQQDVIIDWQAALKQSANKEDLAKDM
LRMLIEFIPEVEAVVDQALEQEDISRDDLIHVIHKLHGSSSYCGVPRLKSLCATLEQALR
SGISLEEVEPEMFELQDEMIKVTTTAKLYLEQ
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaccagatatggcttacgagcacgtgtaattacactgactctcgctcccactctcatc
attggtttattactgagcggttttttctctttcaaccgctaccaagatcttgagaaacaa
gttatcaccactggtaacagcatcattgagccgttagcaattgccagtgaaactcatcta
ctatcagaaagccgagaggcggtacgtcgcttgataagctacgcccatcgcaaaaactct
aaactggttcgtagtatcgcggtgtttgatgaacatcatgagctcttcgtgacatctaac
tttcaccctaatttcgaagccttgatgttccctaaagataaaccgatcccgcaactgggc
aattcggaaatctacgaaaactcactgatattgcgcgtacctattttgtccgagggtcac
tatttagctgagctgtcgaacgaaagccaaggaaccaaagcaattggttatattgccgtt
gagttagatctctcctctttaaggctgcaacagtatcaagaagttttctctgctttttta
gttcttatactcggtcttggcttggcaagtgtgtttgcttcacgtctgatgcacgatgtt
acccagcctatcacccacatgaagaatgtcgttgaccgcatccgccgtggtcacctagac
gtgcgtatcgaaggtaaaatgcatggtgagttagaccaactgaaaaacggtattaacgcc
atggcggtatctctatcggaatatcacgtggagatgcagcacagtatagaccaagctaca
tcagacttgcgtgaaacgcttgagcagctagagattcagaacgttgagttagatatcgcg
aagaaacgtgcgcaagaagcggccagggttaaatctgagttcttggcgaacatgtcgcac
gaactgcgtactccgctcaatggggttattggctttactcgtcaaatgcttaaaacgcag
ctttctaacagccaaactgattacctacagacgattgagaaatcggcgaacaatctactg
aacatcatcaatgacattctcgacttctcgaaacttgaggcgggtaagctggcgctggaa
aacattccgtttgatttccgagaaagtttagaagaagtgattaacctacaagccacaagt
gcacatgagaaagggttagaaatcaccctaaaagtggaccctaaaattccaccgggttta
gttggggacccactacgtatccagcaaattttgacgaacttagtcggtaactcaatcaag
tttaccgagcgaggcaacattgatgttagcgttgaaatgcgctctcaatcaggggactcc
gtcgaactgcaattcatggtgcgtgataccggcattggtatttctgaacgtcagcaagcg
caattattccaagcatttagccaagcggatgccagcatttcacgtcgctacggcggcact
gggttaggtttggttatcacgcagaaattggtaagccagatgggtggcgagatcagctta
accagccgcctacaccaaggttcgacgttctggtttacggtgcgcttgcactcaaccgaa
atgccgatgagcgaactgattgaagtggaacttctgactggcaaacagttgctattgatt
gaaccaaacatgcaagccgcatccgtaacccaacagattctaagtcaagaaggtatctta
gtaacctaccgctcttcgctaccgaaaaacgaagaacaatatgactatgtattactgaat
ttagcggcaaatcaaacgcatgatgcagacgtcattacaccttggatagaacaagcgaaa
cgcatggctccgagtgtgatcctagggacgccgagtaccgaactggcacttgccgaccaa
attatgacagagcatcacgtccaatgcctgacgaagccgttgtctcgccgtaaactgcta
caaagcctaattagcgaacatgtcgaatcaccaccaacattgagtgctccaattacgcca
agcgaaggggagcgtttacctctgacggtgttagcggtggatgataacccagcgaacttg
aagctgatttccgctctgctccgcgaacgagtagaaaccgtcaccgcctgtagcaatggc
cagcaagcggtgaacctggcgacggagaaaaagtacgacttaatcttcatggatatccaa
atgccgcaaatggatggtgtgaccgcttgtcagcacattaaagagttggagttaaacaaa
gatacgccagtgattgcggtaacggcgcatgccatggcgggagaaagagaccgcttgctc
tcggctggaatggatgattacttaaccaaacctattgaagagcatgtgctacaacaggtt
ttggttcactggaacccaaatgcttgtactgagagcattggcaaagtcgccccttcatac
gttgatgagcctgaagggagcgcaccacaatccgtttcttcgcctcagcaggatgtgatt
attgattggcaagctgccttaaaacagagcgcgaataaagaggatctagccaaagacatg
ctgcgcatgttgattgagttcatccctgaagtagaagcagtcgttgaccaagctctggag
caagaagatatctcccgtgatgacctaattcatgtcatccataagctgcacggcagtagc
tcatattgcggagtgcctaggctgaaatcactctgtgcgacgcttgagcaagcactgcgc
tcagggatcagtcttgaggaggttgagcctgaaatgttcgagctgcaagatgaaatgatt
aaagtcacaacgactgcaaaattataccttgaacagtaa

DBGET integrated database retrieval system