KEGG   Vibrio antiquarius: VEA_003084Help
Entry
VEA_003084        CDS       T01107                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vex  Vibrio antiquarius
Pathway
vex00260  Glycine, serine and threonine metabolism
vex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01130  Biosynthesis of antibiotics
vex01230  Biosynthesis of amino acids
Module
vex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VEA_003084
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VEA_003084
Enzymes [BR:vex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VEA_003084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACY51244
Position
1:complement(1647312..1648502)
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPEFRSEFMTLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
EDAHYLLGTAAGPHPFPTIVRDFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDPNGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDNVTDDEALEAFQELARSEGIIPALESSHALAHALRM
ARENPEKEQLLVVNLSGRGDKDIFTVHAILEEKGVI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgaatgcctactttggcgaatacggcggtcagtacgttccgcaaattcta
gttccagcactggagcaactagagcaagcgtttatcgacgcgcaagaagatccagaattc
cgcagcgaattcatgacgcttcttcaagagtatgcgggccgtccaacggctttgactcta
actcgtaacctaaccaaaggtacgaaaaccaaactgtacctaaaacgtgaagatctgctt
cacggtggcgcgcacaagaccaaccaagtgttaggtcaagctctgcttgcgaaacgcatg
ggtaaaaacgaaatcatcgcagaaaccggcgcaggtcaacacggcgtagcaactgcacta
gcgtgtgcgctacttggtctgaaatgtcgtgtttacatgggtgcaaaagacgttgaacgc
caaagcccgaacgtattccgtatgaaactcatgggtgcagaagtaattccggttcactca
ggttcagcaacacttaaagacgcatgtaacgaagcgctacgcgactggtctgcaacttat
gaagacgcgcactacctactaggtacagcggctggtcctcacccattcccaaccatcgtg
cgtgatttccaacgaatgatcggtgaagaaacgaagaatcagattttggcacgtgaaggt
cgtcttcctgatgcagttatcgcgtgtgtgggcggcggttcaaacgcgattggtatgttt
gctgacttcatcgaagaagaaagcgttcgcctcattggtgttgagccagcaggtaaaggt
atcgatactgaccaacacggtgcaccacttaaacatggcaaaacggggatcttctttggt
atgaaagcgccattgatgcaagatccaaacggccaagttgaggagtcttactctgtatct
gcgggtcttgatttcccttctgtaggaccacagcacgcacacctaaatgcaattggccgt
gcggaatacgacaacgtaactgacgacgaagcgctcgaggcattccaagaattggctcgc
agcgaagggatcatcccagctctagagtcttctcacgctctagctcatgcattgcgcatg
gctcgtgagaatcctgagaaagaacaactattggtcgtaaacctatctggtcgtggtgac
aaagacatcttcaccgtacacgccatcctagaagaaaaaggagtgatttaa

DBGET integrated database retrieval system