KEGG   Vibrio antiquarius: VEA_003824Help
Entry
VEA_003824        CDS       T01107                                 

Definition
(GenBank) alpha-1,6-galactosidase putative
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
vex  Vibrio antiquarius
Pathway
vex00052  Galactose metabolism
vex00561  Glycerolipid metabolism
vex00600  Sphingolipid metabolism
vex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VEA_003824
  Lipid metabolism
   00561 Glycerolipid metabolism
    VEA_003824
   00600 Sphingolipid metabolism
    VEA_003824
Enzymes [BR:vex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VEA_003824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_31 Raffinose_syn GHL6 GHL10
Motif
Other DBs
NCBI-ProteinID: ACY51984
Position
1:complement(2454463..2456202)
Genome map
AA seq 579 aa AA seqDB search
MAQSIQLANHIEITVNNNDLQVEVEGNQLHFSFAGLHNKTFTDREVLFEMPFLYEHEANV
IGDGFQMLAQTAGTVSYPVDIGRCPDNNPSYRIYPKDAPKRYYNYLVVEGSAGYILFGFT
SCHRFAGYFDVVLRDGHWVLSAAIDGEFTQVADWESNQLESVAVLCGQSLSELYQIYGEM
IAEHHPVRQGVTQDAPVGWCSWYAYYADVTEQNIMQNVDCMQDKLEDLEWVLLDDGYQAF
MGDWLIPSDKFSGGVKELIHSIRAKGKKPAIWMAPFIAQPESEIFKQHPEWFVRHKDGSL
LKAEDVTYGGWRCTPWYILDTSNPEVQDHLTNVVSVMRQEWGVELFKLDANYWGTLKGVR
KQSGITGVEAYRLGMEAIAKGAGDAWLLGCNAPMWPSLGLVDAMRVSDDVERHSRRFEQI
AKETFYRSWQHRKLWQIDPDCATFTSLANQAASREEYEFHRTVLLACGGLLLSGDPLPEI
TPFAKKTLAKLMLRQQRNQESAKFTALSLNHAFLKLTTKNDLHCLFNYASYGAMEFTLTS
DQPMDWYDYWTGEKLNQEPCQLLMVSVDKGLNAKAIVTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctcagagcattcaattggcaaatcacattgagatcactgtgaataacaacgacctc
caagttgaagttgagggtaatcaattacatttttcttttgctgggcttcacaataaaacg
tttaccgaccgtgaagtgttgttcgagatgccgtttttatacgagcacgaggccaatgtg
attggcgatggcttccaaatgctggcgcaaacagcgggaacggttagctatcccgttgat
attggtcgctgtccagacaacaacccttcttatcgaatctatcccaaagatgcccctaag
cgttactacaactatttagtggtggaaggctcggctggctatatcttgtttggctttact
tcatgtcaccgttttgcgggctattttgatgttgtactgcgtgatggacattgggtttta
tcggccgcgattgatggtgagtttactcaagtggcggattgggaaagtaatcaacttgaa
tccgtggcggtactctgcggccaatctctgtctgagctttatcaaatctatggagagatg
attgcagagcatcatcctgttcgccaaggtgtgacacaagatgcgcctgtcggttggtgt
tcgtggtatgcctactacgcagacgtgacagagcaaaacatcatgcagaacgttgattgc
atgcaagataagcttgaagacctagagtgggtacttctggatgatggctatcaagccttt
atgggcgattggttaatcccatcggataagttttctggtggtgtgaaagagctcattcat
agtatccgtgcaaaaggcaaaaagccggcgatttggatggccccctttattgctcaacct
gagtcggagatcttcaaacaacacccagagtggtttgttcgtcacaaagatggaagctta
cttaaagcagaagatgtcacatacggtggttggcgctgcacgccttggtacatactcgat
acctcaaatccagaagtgcaagaccatctgacgaatgtggtctctgtcatgagacaagag
tggggcgttgaattgttcaagctagacgcgaactattggggcaccttgaaaggtgtgcgt
aaacagtctggtattaccggcgttgaggcgtatcgcttaggaatggaagcgattgctaaa
ggcgctggtgatgcgtggcttttaggttgcaacgcgccaatgtggccatctctagggctt
gtggatgcaatgcgtgtttctgatgacgtagaacgccatagtcgtcgtttcgagcagata
gccaaagaaaccttttatcgtagttggcagcatcgaaaactgtggcaaattgatccggat
tgcgcgacattcacgtcattagctaatcaagccgcatccagagaagagtatgaatttcat
cgcacggtgttattggcgtgtggtggtttgctgctgtctggcgatccgctccctgagatt
acgccatttgcaaagaagacattggctaagctcatgctacgtcaacaacgtaaccaagag
tcagcaaagttcacggctttgagtttaaatcatgcgtttttaaaactaacgacgaagaat
gaccttcactgcttgtttaactatgccagctacggggcgatggaatttacgctgacgtct
gatcaaccgatggattggtatgattactggacaggagaaaagctaaaccaagaaccttgt
cagttattaatggttagcgttgataaagggttaaatgcgaaagcgatcgtcacggcataa

DBGET integrated database retrieval system