KEGG   Vibrio antiquarius: VEA_004206Help
Entry
VEA_004206        CDS       T01107                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vex  Vibrio antiquarius
Pathway
vex00900  Terpenoid backbone biosynthesis
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01130  Biosynthesis of antibiotics
Module
vex_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VEA_004206
Enzymes [BR:vex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     VEA_004206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Hce2
Motif
Other DBs
NCBI-ProteinID: ACY52364
Position
1:2879584..2880456
Genome map
AA seq 290 aa AA seqDB search
MIELSTRWPSPAKLNLFLYINGRTENGYHELQTLFQFVDHGDELTIKANESGEITISPEI
EGVPLKDNLIWKAATALQAYSNCPFGAHIELQKVLPMGGGIGGGSSNAATALVALNYLWQ
LNLTDDELAEIGLKLGADVPVFVRGFAAFAEGVGEKLSPAYPEEKWYLVVRPNVSIATVD
VFCHPDLTRNTPKRDLETLLNTPSVNDCEKIVRMLYPEVDKQLSWLLQYAPSRLTGTGSC
VFAEFSSKSEAETILAQLSDKVSAFVAQGRNISPLKETLAEYQSASHRPI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactttcaacccgctggccatcgccagcgaaattgaatctctttctatacatc
aacggtcgcacagaaaatggctaccacgagttacaaaccttattccaattcgtcgatcac
ggcgatgaactgaccataaaagccaacgagtctggcgagatcaccatttcccctgaaatc
gaaggcgttccgctaaaagacaacctaatatggaaagcagcaaccgcgcttcaagcttac
tcaaactgcccttttggcgcgcatattgagctacagaaagtgctgcctatgggtgggggc
attggtgggggctcatcgaatgcagctacagcactagtggcactgaactacttgtggcaa
ctgaatctaactgacgatgaactggctgaaattggtttaaagttgggcgcagacgtgccc
gtatttgtgcgcggatttgcagctttcgctgaaggtgttggcgagaaactctcccccgct
tatccagaagaaaagtggtatttagtcgtcagaccgaatgtttctatcgcaaccgtcgac
gttttttgtcatccagatctaacgcgaaacaccccaaaacgagatctagaaacactttta
aatacgccaagcgtaaacgattgcgaaaaaattgtacgaatgctctacccagaggttgat
aagcaactttcttggctgctacaatacgcgccgtcaagattgacggggacaggatcttgc
gtttttgctgaattttcgagcaaatctgaagcagaaactatccttgcacaactctctgat
aaagtctcggcatttgtcgctcaagggcgcaatatttcgccattaaaagagactttggct
gaataccaatcagcctcacaccgacctatttaa

DBGET integrated database retrieval system