KEGG   Vibrio antiquarius: VEA_004372Help
Entry
VEA_004372        CDS       T01107                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vex  Vibrio antiquarius
Pathway
vex00620  Pyruvate metabolism
vex00630  Glyoxylate and dicarboxylate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01200  Carbon metabolism
Module
vex_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEA_004372
   00630 Glyoxylate and dicarboxylate metabolism
    VEA_004372
Enzymes [BR:vex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VEA_004372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACY52530
Position
1:complement(3065812..3067440)
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQQLKQTQGMLEVNGVVAPEHQAIFPVEAQTFLSLLCEKFAGRVEQLLEARE
EKQARIDAGELPDFLPETQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWSKVLDGQVNLRDAVNGTISYINPGNGKHYQLEDDPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNYKALLQKGSGPYFYIPKLQSHHEAKWWSEVFHF
TEDYFGLDTGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKKHP
ERVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKNPQENQKVLDKIQT
DKSLEANNGHDGTWVAHPGLADTAMEVFSAVLGERTNQLDVSRSEDAPITAAELLEPCEG
ERTEAGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
LKVTKDLFELYLKEEIEVVKQEIGEQRYQAGRFEEAADLMARLTTSDELTNFLTVPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaacaactaaagcaaacccaaggcatgcttgag
gtgaatggagtcgttgctccagaacatcaagcaattttccctgttgaagcccaaaccttt
ttatctctactgtgtgaaaaatttgccggacgtgttgagcagttgctggaagcacgagaa
gagaagcaagcgcgtatcgatgcaggtgagctgccagactttttaccagagacacaagac
atccgtgaaggaagctggaagatcctgggaatcccacaagatctgcaagatcgccgtgtg
gagattaccggaccaactgatcgcaagatggtgattaacgcactgaatgcgaatgtaaaa
gtgtttatggcagacttcgaagattcaatgtctccagcatggagtaaagtgctggatggg
caagtgaatttacgcgatgccgtgaatggcaccatcagttacatcaaccctggcaatggc
aagcattatcagctggaagatgacccagcggtgttgatctgccgtgttcgcggccttcat
ttaaaagaaaaacacgttacgtggcacggtcagatcattccaggtgcgctattcgatttc
gctctgtacttctataacaactacaaagcgttacttcaaaaaggcagcggcccttatttc
tacattccaaaactgcaatcgcatcacgaagcgaagtggtggagcgaagtgttccatttc
acggaagactatttcggtcttgatacaggcaccatcaaagcgacagtgctgattgaaacc
ttaccagccgtattcgaaatggatgagattctgttctcacttaaagaacacatcgttggt
ttgaactgtggtcgctgggattacatctttagctacatcaaaaccttgaagaagcaccct
gaacgcgtactgccagatcgccaagtggttacgatggataagccattcttgaacgcttac
tcgcgattattggtgcgtacttgtcataaacgaggtgctttcgcgatgggaggaatggcc
gcctttatcccagcgaaaaacccgcaagagaatcaaaaagtattagacaagatccagact
gacaaatcgctagaagcaaacaacggtcacgacggtacttgggtagctcatccaggtttg
gctgacaccgcgatggaagtttttagtgctgtactgggcgagcgcaccaatcaattggat
gtgagtcgttcagaggatgcacctattacagcggctgaactacttgagccttgtgaaggc
gagcgtacagaagccggaatgcgccacaatattcgtgttgcgctgcaatacatcgaagct
tggatttctggtaatggttgtgtaccaatttatggcttgatggaagatgcggcgacagct
gaaatctctcgcgcttctatctggcaatggattcaacacggcaagtcgctagataacgga
ttgaaggtcactaaggatctgttcgagctctatctaaaagaagagattgaagtcgtgaaa
caagaaattggtgagcagcgctaccaagcgggtcgatttgaagaagcggcagacttgatg
gcaagactcaccacaagcgatgagctgaccaactttttaacagttcctggttatgactac
ctggattaa

DBGET integrated database retrieval system