KEGG   Vitreoscilla filiformis: VITFI_CDS0676Help
Entry
VITFI_CDS0676     CDS       T04960                                 

Definition
(GenBank) Phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00360  Phenylalanine metabolism
vff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vff00790  Folate biosynthesis
vff01100  Metabolic pathways
vff01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    VITFI_CDS0676
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VITFI_CDS0676
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VITFI_CDS0676
Enzymes [BR:vff01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     VITFI_CDS0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ASM76455
UniProt: A0A221KBU9
Position
complement(721383..722222)
Genome map
AA seq 279 aa AA seqDB search
MRTSPPPGPDGLIEQRWADYSAIEHATWRTLFERQTRLLQGRACDAFLDGLARLPLSAEH
IPDFAQLNRVLRPRTGWEVVAVPGLVSDEVFFAHLAARRFPAGHFIREPHQLDYLEAPDV
FHDVFGHLPMLMHPVMADFIQAYGEGGLRAQRLGCLPMLARVYWYTVEFGLVQQADGLRL
FGAGIASSATETVYCLDDPAPHRLRFELPRVLRTRYRIDDVQAAYFVLNDLDELLALAHT
DFAPFYAAAQTQPELAPGELLPTDTVLHRGHVRRNALAI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaagccccccacctgggcccgatgggctgattgaacagcgttgggccgattac
agcgccatcgaacatgccacctggcgcacgctgttcgaacgccaaacacgcttgctgcaa
ggccgtgcgtgcgatgcgtttctggacggcctggcccggctgcccctcagcgccgaacac
atccccgacttcgcgcagctcaaccgtgtgctgcgcccgcgcaccggctgggaggtggtg
gcggtgcccggtttggtgagtgatgaggtgttcttcgcgcatctggcggcgcggcgcttt
ccggcggggcacttcatccgcgaaccgcaccagctcgactacctcgaagcgcccgatgtg
ttccacgacgtgttcggccacctgcccatgctgatgcatccggtgatggccgacttcatc
caagcgtatggcgaaggcggcttgcgcgcccaacgcctgggctgcttgccgatgctggcg
cgggtgtactggtacacggtggaattcgggctggtgcagcaggcggatgggctgcggctg
tttggcgcgggcattgcgtcttcggcgacggaaacggtgtactgcttggatgaccccgcg
ccgcaccgcctgcgctttgagctgccccgcgtgctgcgcacacgctaccgcatcgacgat
gttcaagccgcctatttcgtgctgaacgatctggacgagctgctggccctggcgcacacc
gactttgcgccgttttacgccgccgctcaaacgcagcccgaactggccccaggcgaattg
ctgcccacggacactgtgctgcaccggggccacgtccggcgcaacgcactggccatctga

DBGET integrated database retrieval system