KEGG   Vitreoscilla filiformis: VITFI_CDS0773Help
Entry
VITFI_CDS0773     CDS       T04960                                 

Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
vff  Vitreoscilla filiformis
Brite
KEGG Orthology (KO) [BR:vff00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VITFI_CDS0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11
Motif
Other DBs
NCBI-ProteinID: ASM76552
UniProt: A0A221KC01
Position
complement(830852..831154)
Genome map
AA seq 100 aa AA seqDB search
MYAFAYTLTLRNTGPAAAQVIARHWVIQDGAGHVENVRGLAVVGQQPLIKPGGQFEYTSW
TRIATPRGTMRGTLFCITENAHWFELPIPAFELSQSQALH
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgcgtttgcctacaccctgaccctgcgtaacaccggccccgcggccgcccaagtg
atcgcccggcactgggtgattcaagacggcgcgggccatgtggaaaacgtgcgtgggctg
gccgtggtgggccaacagcccctgatcaaacctggcggccagtttgagtacaccagttgg
acgcgcatcgccactccacgcggcacgatgcgcggcaccttgttctgcatcaccgagaac
gcacactggttcgagctgccgattccagcgtttgagctgtctcagagtcaggcgctgcac
tga

DBGET integrated database retrieval system