KEGG   Vitreoscilla filiformis: VITFI_CDS1735Help
Entry
VITFI_CDS1735     CDS       T04960                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00450  Selenocompound metabolism
vff00970  Aminoacyl-tRNA biosynthesis
vff01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VITFI_CDS1735
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VITFI_CDS1735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vff01007]
    VITFI_CDS1735
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vff03016]
    VITFI_CDS1735
Enzymes [BR:vff01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VITFI_CDS1735
Amino acid related enzymes [BR:vff01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VITFI_CDS1735
Transfer RNA biogenesis [BR:vff03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VITFI_CDS1735
 Prokaryotic type
   Other AARSs
    VITFI_CDS1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ASM77513
UniProt: A0A221KFE1
Position
complement(1812747..1814789)
Genome map
AA seq 680 aa AA seqDB search
MTRKLFVTTALPYANAPFHVGHMMEYIQADIWVRAQRMKGAQVHFVCADDAHGAPIMIAA
EKAGKTPQQFVGEVAAGRAKYLNGFHIAFDNWHSTDGPENHELAQDIYRALRKNELISVK
SIEQFFDPEKGMFLPDRFIKGECPKCGAKDQYGDNCDACGAVYAPTELKNPYSALSGATP
VMKTSDHYFFKLSDPRCVEFLEGWTSTPGRLQPEVLNKIKEWFTKDDDGNGGLGDWDISR
DAPYFGIEIPDAPGKYFYVWLDAPIGYLASLKNYFGKIGQDYDAFFADPNVEQVHFIGKD
ITYFHTLFWPAMLHFSGRKTPDKVNVHGFITVSGEKMSKSRGTGISPLKYLELGMHPEWL
RYYIAAKLNSRVEDIDFNPDDFIARVNSDLVGKYINIASRAAGFLTKRFGGQLSTDLGVE
GNTLLDALRAHRATLEQLFEEREYGKALREIMALADKVNEYVDANKPWELAKKEGADALL
QDVCSTCIEAFRVLTIYLKPVLPALAANVEAFLKVSPFTFADVEQALGAHVIGEYKHLMQ
RVDPKLLDALFEPPAPIQVVPGGEPLAPEIKIDDFSKVDLRIAKIVKAEEVPGSDKLLRL
TLDVGEGKTRNVFSGIKSAYKPADLEGKLTVMVANLAPRKMKFGLSEGMVLAASHADEKA
HPGIFVLEPFPGAQPGMRVR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaaacttttcgtcaccaccgccctgccctacgccaacgcgcccttccacgtc
gggcacatgatggagtacatccaggccgacatctgggtgcgggcgcagcgcatgaagggt
gcgcaggttcacttcgtctgcgctgacgacgcgcacggtgcgccgatcatgatcgccgcc
gaaaaagcgggcaaaacgccgcagcagtttgtgggtgaagtggccgccggacgcgccaag
tacctgaacggtttccacatcgctttcgacaactggcactccaccgacggcccagaaaac
cacgaactcgcgcaagacatctaccgcgccctgcgcaagaacgagctgatcagcgtgaag
tcgattgaacagttcttcgacccggaaaaggggatgttcctgccggatcgtttcatcaag
ggcgagtgcccgaagtgcggcgccaaagaccagtacggtgacaactgcgatgcctgcggc
gccgtctacgccccgaccgagctgaaaaacccgtactcagccctgtccggtgccacgccg
gtgatgaagacttcggatcactactttttcaagctgtccgacccacgttgcgtggagttt
ctggaaggctggacaagcacgccgggccgcctgcaacccgaagtgctgaacaaaatcaag
gagtggttcaccaaggatgacgacggcaacggcggcctgggtgactgggacatcagccgc
gatgcgccttacttcggcatcgaaatccccgatgcgccgggcaaatacttctatgtgtgg
ctggacgcgccgattggctacctggcttcgctgaagaactacttcggcaagatcggccaa
gattacgacgcgttttttgccgacccgaacgtcgagcaagttcacttcatcggcaaggac
atcacctacttccacaccctgttctggccggcgatgctgcacttcagtggccgcaagacg
ccggacaaggtgaacgtccacggtttcatcaccgtcagcggcgagaagatgagcaagagc
cggggcacgggcatcagcccgctcaagtatttggagctgggcatgcacccggagtggctg
cgttactacatcgccgccaagctcaacagccgcgtggaagacatcgacttcaacccggat
gacttcatcgcccgcgtgaactcggacttggtgggcaagtacatcaacattgcttcgcgt
gcagcgggcttcctcaccaagcgctttggcggccagctctccaccgatctgggcgtggag
ggcaacacgctgctggacgcgctgcgtgcccaccgcgccaccctcgaacaactgtttgag
gaacgcgagtacggcaaggcgctgcgcgaaatcatggcgctggccgacaaggtcaacgag
tacgtggacgcgaacaagccttgggagctggcgaagaaagaaggcgccgacgcgctgctg
caagacgtgtgcagcacctgcatcgaagccttccgcgtgctcaccatctacttgaagccg
gtgctgcctgcgctggcggccaacgtggaagccttcttgaaggtgtcgccgttcactttc
gcggatgtggaacaggcgctgggcgcccacgtcatcggtgaatacaagcacctgatgcaa
cgcgtcgatccgaagctgttggatgcgctgtttgagccgccggcgcccatccaagtggtg
ccgggcggtgagccgctggcgcccgaaatcaagatcgatgatttcagcaaggtggatttg
cgcatcgccaaaatcgtcaaggccgaagaagtgccgggctcggacaagctcctgcgcctc
accctggatgtgggcgaaggcaagacgcgcaacgtgttttccggcatcaagagcgcttac
aaacccgccgatctggaaggcaaactcaccgtgatggtggccaacctggcaccgcgcaag
atgaaatttggcctgagcgaaggcatggtgctggccgccagccatgccgacgagaaggcg
caccccggcatcttcgtgctggaaccgttccccggcgcacaacccggtatgcgcgtgcgc
tga

DBGET integrated database retrieval system