KEGG   Vitreoscilla filiformis: VITFI_CDS1798Help
Entry
VITFI_CDS1798     CDS       T04960                                 

Definition
(GenBank) 5'-nucleotidase stationary phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00230  Purine metabolism
vff00240  Pyrimidine metabolism
vff00760  Nicotinate and nicotinamide metabolism
vff01100  Metabolic pathways
vff01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VITFI_CDS1798
   00240 Pyrimidine metabolism
    VITFI_CDS1798
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VITFI_CDS1798
Enzymes [BR:vff01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     VITFI_CDS1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ASM77576
UniProt: A0A221KEY9
Position
1880157..1880918
Genome map
AA seq 253 aa AA seqDB search
MISNDDGYLAPGLLALVQACQGLAEVDVVAPEQNASGTSNSLSLHRPLSVFKATTGAQAG
FHYVNGTPSDCVHIALTGLLPQRPDLVISGINQGANMGDDTLYSGTVAAAMEGYQFGIPA
VAFSQVDRGWAHLDAAAATARRVLESVWPQVAQAQQTRRPWLLNVNMPNEPDTASLPWAV
TRLGRRHASEPVIRQISPRGDTLYWIGAAGAACDGAAGTDFHATEHRQVSITPLHVDLTD
HASLPEWAARLQP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgatttccaatgacgacggctacttggcgcccggcctgctggccttggtgcaagcatgc
caagggctggccgaggtggacgtggtggcgccagagcaaaacgccagtggcacctccaat
tcgctgagtttgcatcggcccctgtcggtgttcaaagcgaccacgggggcgcaggctgga
tttcactacgtcaacggaacgccgtcggattgtgtccacatcgcgctgactgggttgctg
ccgcaacggcccgatttggtcatttctggcatcaaccaaggcgccaacatgggcgacgat
acgctgtactctggcacagtggccgcagcgatggaggggtatcaattcggcatcccggcg
gtggctttttcgcaggtggatcgcgggtgggctcacctggatgcagccgccgccacggcc
cgtcgggtgctggagtctgtgtggccccaagtggcgcaggcccagcagacgcgccggcca
tggttgttgaacgtcaacatgcccaacgagcccgacacggcatcgctgccgtgggccgtg
acgcggctggggcggcgccacgccagcgaaccggtgattcgccaaatcagtccacgcggg
gacacgctctactggatcggcgcagcaggtgccgcctgcgacggcgccgcaggcacagac
tttcacgccacggagcaccgccaggtgtccatcacgccgctgcacgttgatctgaccgac
cacgccagcttgccggaatgggctgcccgcctgcaaccatga

DBGET integrated database retrieval system