KEGG   Vitreoscilla filiformis: VITFI_CDS1974Help
Entry
VITFI_CDS1974     CDS       T04960                                 

Definition
(GenBank) cystathionine beta-lyase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00270  Cysteine and methionine metabolism
vff00450  Selenocompound metabolism
vff01100  Metabolic pathways
vff01110  Biosynthesis of secondary metabolites
vff01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VITFI_CDS1974
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VITFI_CDS1974
Enzymes [BR:vff01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     VITFI_CDS1974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Abhydrolase_6
Motif
Other DBs
NCBI-ProteinID: ASM77752
UniProt: A0A221KFC1
Position
2051082..2051417
Genome map
AA seq 111 aa AA seqDB search
MRRVLHPSLPGSPGHAHWAALCQAAAGLVTLEIDPRHSSDAVDAFVDGLRHFRIGWSWGG
PVSLAVPYQARFMRKLGHPYEGVLVRLCIGLEDAGDLIADLDAGLQRLAQA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgtgttgcatcccagcttgccgggttcacctgggcacgcgcactgggcggcg
ctgtgccaagccgctgccgggctggtgacgctggaaatcgacccacgccacagcagcgac
gcggtggacgcgttcgtcgatgggctccggcatttccgcatcggctggagttggggcggg
ccggtgagtttggcggtaccctatcaggcgcggttcatgcgcaagctggggcacccgtac
gagggtgtgctggtgcgcctgtgcattggcctcgaagacgcgggcgacctcatcgccgat
ctggacgctgggttgcagcgtctggcccaagcttga

DBGET integrated database retrieval system