KEGG   Vitreoscilla filiformis: VITFI_CDS2052Help
Entry
VITFI_CDS2052     CDS       T04960                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00071  Fatty acid degradation
vff00072  Synthesis and degradation of ketone bodies
vff00280  Valine, leucine and isoleucine degradation
vff00310  Lysine degradation
vff00362  Benzoate degradation
vff00380  Tryptophan metabolism
vff00620  Pyruvate metabolism
vff00630  Glyoxylate and dicarboxylate metabolism
vff00640  Propanoate metabolism
vff00650  Butanoate metabolism
vff00900  Terpenoid backbone biosynthesis
vff01100  Metabolic pathways
vff01110  Biosynthesis of secondary metabolites
vff01120  Microbial metabolism in diverse environments
vff01130  Biosynthesis of antibiotics
vff01200  Carbon metabolism
vff01212  Fatty acid metabolism
vff02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VITFI_CDS2052
   00630 Glyoxylate and dicarboxylate metabolism
    VITFI_CDS2052
   00640 Propanoate metabolism
    VITFI_CDS2052
   00650 Butanoate metabolism
    VITFI_CDS2052
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VITFI_CDS2052
   00072 Synthesis and degradation of ketone bodies
    VITFI_CDS2052
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VITFI_CDS2052
   00310 Lysine degradation
    VITFI_CDS2052
   00380 Tryptophan metabolism
    VITFI_CDS2052
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VITFI_CDS2052
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VITFI_CDS2052
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VITFI_CDS2052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vff04147]
    VITFI_CDS2052
Enzymes [BR:vff01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VITFI_CDS2052
Exosome [BR:vff04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VITFI_CDS2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ASM77830
UniProt: A0A221KGA1
Position
2121989..2123128
Genome map
AA seq 379 aa AA seqDB search
MGKFGGTLAKTPAAELGATVIKSLLQRTGVAGEQIGEVILGQVLTAGVGQNPARQAVIRS
GLPQGVPAMTINKVCGSGLKAVMLGAQAIRDGDSDIIIAGGQENMSLSPHVVPGSRDGQR
MGDWKMVDTMINDGLWDAYNHYHMGITAENVAKQYGITRDMQDELALASQQKAAAAQDAG
KFKDEIADVVIPQKKGDPLVFNTDEFLNRKTNAAALAGLRPAFDKAGSVTAGNASGINDG
AAAVMLMSAAKAAALGLPVLGRIASYASAGLDPAIMGMGPVPAARKALARAGWSPADLDL
LEINEAFAAQACAVHKEMGWDLSKVNVNGGAIAIGHPIGASGCRILVTLLHEMQRRDAKK
GIASLCIGGGMGVALTIER
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaagtttggcggcacgctggccaaaaccccggctgcggagctgggcgcgaccgtc
atcaagtcgctgctgcaacgcaccggcgtggcaggcgagcaaatcggcgaagtgatcctg
ggccaagtgctgaccgctggcgtgggccagaacccggcccgtcaagccgtgatccgctcg
ggcctgccgcaaggcgtgccggccatgaccatcaacaaggtttgcggttcgggcctgaag
gctgtgatgctgggcgcccaagccatccgtgacggcgactccgacatcatcatcgcgggc
ggccaagaaaacatgagtctgagcccgcacgtcgtgcccggctcgcgtgatggtcagcgc
atgggcgactggaaaatggtcgacaccatgatcaacgatggcctgtgggatgcctacaac
cattaccacatgggcatcaccgccgagaacgtcgccaagcagtacggcatcacccgtgac
atgcaagacgagctggcgctggcctcgcagcaaaaagccgctgccgctcaagacgccggc
aagttcaaggacgaaatcgccgatgtggtgatcccgcagaaaaagggcgatccgctggtg
ttcaacaccgacgagttcctgaaccgcaagaccaacgccgccgccctggctggcctgcgc
ccggcctttgacaaggcgggcagcgtcaccgctggcaacgcctcgggcatcaacgacggc
gccgctgccgtgatgctgatgagcgccgccaaggccgctgcactgggcctgccggtgctg
ggccgcatcgccagctacgccagcgctggtctggatccggccatcatgggcatgggcccg
gtgccggcggctcgcaaggccctggcccgcgctggctggagcccggccgatctggacttg
ctggaaatcaacgaagcctttgccgctcaggcctgcgccgttcacaaagaaatgggctgg
gatctgagcaaggtgaacgtcaacggtggtgccatcgccatcggtcacccgattggtgcg
tcgggctgccgcatcctggtgacgctgctgcacgaaatgcagcgccgtgacgccaagaag
ggcattgcctcgctgtgcattggcggtggcatgggcgttgcattgacgatcgaacgctga

DBGET integrated database retrieval system