KEGG   Aliivibrio fischeri ES114: VF_1449
Entry
VF_1449           CDS       T00236                                 
Symbol
rbsR
Name
(GenBank) transcriptional repressor RbsR, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
vfi  Aliivibrio fischeri ES114
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vfi03000]
    VF_1449 (rbsR)
Transcription factors [BR:vfi03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    VF_1449 (rbsR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_31 HTH_Tnp_ISL3
Other DBs
NCBI-ProteinID: AAW85944
UniProt: Q5E4V2
Position
I:1599955..1600962
AA seq 335 aa
MATIKDVAKHASVSTSTVSHVLNKTRFVSEDISERVMAAVAELNYAPSALARSLKVNHTK
TFGMLVTTSTNPFFGEVVKGVERRCYEKGYNLILCNTEGDAERVHSSLDTLLQKRVDGLL
LMCTEIENQVLELFSRYQPVPTVVMDWGLIDFPSDKIQDNSHHGGYLATKHLIEQGHTEI
GCLTGPLNKLQAQQRLSGFVQAMEESGLEINKNWIASGNFECEGGEAAFNEIHAKGKLPT
ALFVCNDMMAMGMINCASKKGISVPNDISIVGYDDIKMAKYITPSLTTIHQPKHRLGQQA
VDSLLEKIATKSETNRVFQLEPTLMVRDSVKTLSN
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcaacaatcaaagatgtagccaaacatgcaagtgtctcaacctcaacagtaagtcat
gttttaaataaaactcgatttgttagcgaagatatttcagaacgtgtcatggccgcagta
gcagaactaaactatgcgccttctgccctcgcccgcagtttaaaagtcaatcatacaaaa
acctttggcatgttagtgacaacctcaacgaacccattttttggtgaagtggtaaaaggg
gtagaacgtcgctgctatgaaaaaggctataacctcatcttatgtaataccgaaggtgac
gcagagcgtgttcattcaagcttagataccttgctacaaaagcgtgtcgatggcttgtta
ctgatgtgtaccgaaatcgaaaatcaagtgcttgagctcttttctcgttatcaaccggtt
cctaccgttgtaatggattggggattgattgattttccaagcgacaaaattcaagacaac
tcgcaccacggtggctatctggcaacaaaacaccttattgaacaaggtcacactgaaatt
ggttgtttaactggtcctctcaataagttgcaagcacaacaacgtttaagtggttttgtg
caagcaatggaagagtcaggattagaaatcaataaaaactggattgcatcaggcaatttt
gaatgtgaaggcggtgaagcggctttcaacgaaattcatgctaaaggcaaactaccaacg
gcattatttgtttgtaatgacatgatggcaatgggaatgatcaattgcgcaagtaaaaaa
ggcatttcagttcctaatgacatttcaattgttggttatgatgacattaaaatggctaaa
tacatcacgccatcacttactaccattcatcaaccaaaacaccgattaggccaacaagcg
gtcgattcactactagaaaaaatagcaacaaaatcagaaacgaatcgagtttttcagcta
gagcctacactcatggttcgagacagcgtaaagacgctatcaaattag

DBGET integrated database retrieval system