KEGG   Aliivibrio fischeri ES114: VF_1590
Entry
VF_1590           CDS       T00236                                 

Symbol
pflB
Name
(GenBank) pyruvate formate lyase I
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00620  Pyruvate metabolism
vfi00640  Propanoate metabolism
vfi00650  Butanoate metabolism
vfi01100  Metabolic pathways
vfi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VF_1590 (pflB)
   00640 Propanoate metabolism
    VF_1590 (pflB)
   00650 Butanoate metabolism
    VF_1590 (pflB)
Enzymes [BR:vfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     VF_1590 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF2680
Other DBs
NCBI-ProteinID: AAW86085
UniProt: Q5E4G1
Position
I:1781699..1783975
AA seq 758 aa
MAEQFAKAWTGFADGEWQNEVNVRDFIQKNYAPYEGDEEFLVSEGTEATNKLWAKVMEGI
KQENATHAPVDFDTDVISTITAHDAGYIEKDLETIVGLQTDAPLKRAIIPNGGIRMVEGS
CKAYDRELDPSISKIYSEYRKTHNAGVFDIYTPDILKCRKSGVLTGLPDAYGRGRIIGDY
RRVALYGIDFLIKDKLAQFTSLQERFENGEDLTATMQLREEIAEQHRALGQIKQMAAKYG
YDISGPATTAQEAVQWTYFGYLAAVKSQNGAAMSLGRTSTFLDIYIQRDLDAGLITEEQA
QEMIDHFVMKLRMVRFLRTPEYDELFSGDPIWATESMGGMGLDGRTLVTRTNFRFLNSLY
TMGPSPEPNITVLWSEQLPDGFKRFCAKVSIDTSSIQYENDDLMRPDLQSDDYAIACCVS
PMVVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKEAPMADEVLDYAKVMDRLDH
FMDWLAKQYVTALNSIHYMHDKYSYEASLMALHDRDVRRTMACGIAGLSVAADSLSAIKY
ATVKPVRDEDGIAIDFEIEGDYPKFGNNDPRVDDIACELVSTFMGKIRKLKMYRNAIPTQ
SILTITSNVVYGKKTGNTPDGRQAGAPFAPGANPMHGRDEKGAVASLTSVGKLPFADAQD
GISYTFSIVPNALGKDDDNRRSNLAGLMDGYFHHEANIEGGQHLNVNVLNRETLEDAVKH
PENYPQLTIRVSGYAVRFNSLTTEQQKDVIARTFTESL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcagagcaatttgctaaagcttggacaggttttgcagacggtgagtggcaaaacgaa
gttaacgttcgcgatttcatccaaaagaactatgcaccatatgaaggtgatgaagaattc
ctagtttctgaaggtactgaagcaactaacaagctttgggctaaagtaatggaaggcatc
aaacaggaaaacgcaactcacgcacctgttgattttgatactgacgttatctctaccatc
acagctcacgatgctggttacatcgaaaaagatcttgaaactatcgtaggtctacaaact
gatgctcctctaaaacgtgctatcatccctaacggtggtatccgtatggttgaaggttca
tgtaaagcatacgatcgtgaattagatccttcaatttctaaaatctactctgaataccgt
aaaacacacaatgctggtgttttcgatatctacactccagacatcctaaaatgtcgtaaa
tcaggtgttctaactggtcttccagatgcttacggccgtggtcgtatcatcggtgattac
cgtcgtgtagcactttacggtattgatttcctaatcaaagacaaactagctcaattcacc
tctctacaagagcgttttgagaacggtgaagatctaactgcaactatgcaacttcgtgaa
gaaattgctgagcaacaccgtgcactaggtcaaatcaagcaaatggctgcgaaatacggt
tacgatatttctggtcctgctactactgctcaagaagctgttcaatggacttacttcggc
tacctagctgctgttaaatctcaaaacggtgctgcaatgtctctaggtcgtacttcgact
ttcctagacatctacatccaacgtgatcttgatgctggtcttattactgaagaacaagct
caagaaatgatcgaccacttcgtaatgaagcttcgtatggttcgtttcctacgtactcct
gaatacgatgagctattctctggtgacccaatctgggcaacagaatctatgggtggtatg
ggtcttgacggtcgtacactagttacacgtactaacttccgtttcctaaacagcctatac
actatgggtccttctccagagccaaacatcactgttctttggtctgagcaactacctgac
ggcttcaaacgtttctgtgcgaaagtatctatcgatacttcttctatccagtacgaaaat
gatgacctaatgcgtcctgacctacaatctgatgactacgcaatcgcttgttgtgtatct
ccaatggttgttggtaagcaaatgcaattctttggtgctcgtgctaaccttgcaaaaact
atgctttacgcaatcaacggtggtgttgatgagaagctgaaaatgcaagttggtcctaaa
gaagcgccaatggctgacgaagttcttgattacgctaaagtaatggatcgtctagatcac
ttcatggattggttagctaaacaatacgtgactgctctaaacagcatccactacatgcac
gataaatacagctacgaagcgtctctaatggctcttcacgatcgtgacgttcgtcgtaca
atggcttgtggtatcgctggtctttctgttgcagctgactcactatctgcaatcaaatac
gctacagttaaacctgtacgtgacgaagacggcatcgctatcgatttcgaaatcgaaggt
gattaccctaaatttggtaacaacgacccacgcgttgatgatatcgcatgtgaactagtt
tctacgtttatgggcaaaatccgtaaactgaaaatgtaccgtaacgctatcccaactcaa
tctatccttactattacatctaacgttgtatacggtaagaaaactggtaatacaccagat
ggtcgtcaagcaggtgctccttttgctcctggtgctaacccaatgcacggccgtgatgag
aaaggtgctgtagcatctctaacttcagtaggtaaactaccgtttgctgatgcacaagat
ggtatctcttacacattctctatcgtacctaacgctctaggtaaagacgatgacaaccgt
cgttctaaccttgctggcctaatggatggttacttccaccacgaagcaaacatcgaaggc
ggtcaacacttgaacgttaacgttcttaaccgtgaaactctagaagacgcagttaagcac
ccagagaactacccacaactaactatccgtgtatcgggttacgctgtgcgttttaactct
ctaactactgaacaacaaaaagacgtaatcgcacgtactttcactgaatcactataa

DBGET integrated database retrieval system