KEGG   Aliivibrio fischeri ES114: VF_0037Help
Entry
VF_0037           CDS       T00236                                 

Definition
(RefSeq) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00511  Other glycan degradation
vfi00520  Amino sugar and nucleotide sugar metabolism
vfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VF_0037
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VF_0037
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VF_0037
Chaperones and folding catalysts [BR:vfi03110]
 Intramolecular chaperones
  Others
   VF_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-GeneID: 3279788
NCBI-ProteinID: YP_203420
UniProt: Q5E8W4
Position
I:complement(43328..45775)
Genome map
AA seq 815 aa AA seqDB search
MKKTLLTLSISSFLFSASSLASAPNTKLNLMPYPQSVELNSGQLEITSDFSIYIDGYKSE
RIQQLALRIIQRVEAQTGLPLLTPFASSKKEATLIIDVSKAAKNKIQDNDIDESYELTIN
KKQIILESDRPYGALRGAETFLQLINTSKAGYFVPQVNIEDEPRFPWRGASFDSSRHFVT
VDTIKRQIDGFASAKMNVFHWHLWDDQAIRIQIESYPKLWEKTADGDFYTKEEIKDVVEY
ARLRGIRVIPEISLPGHASAVAHAYPELMSGEGEQSYDQQRAWGVFVPLMNPINPELYVF
FDKVFSEVTELFPDEYIHIGGDEPNYQQWTDNKEIQAFIAENNIDGNRGLQSYLNARIEK
MLNKKGKKIMGWDEIWHKDLPTSIVIQSWRGHDSIGRAAKEGYTGLLSTGFYLDQPQPTS
YHYRNDPMPKGPQVDDQLHSGETFETYTWQKPRGKGGPRKGTLTIITDKNGDARAFTDYN
GKSRAKVDIMEYTKGESFRGHFDNFMSYTEFNLIFNNGNIKKESYQLVGNVRWPTTGEMT
ASSSIKNSVIPAPNGGYPVALNKDEEKLILGGEAAIWAENYDDLTVEGRIWPRTYAVAER
LWSAEELTDEDSMYQRLQAMDSWATISVGLQHQTNSYKQYLRIANGGDVSALMSFANYAE
PAQYYARNWAKYNSTDPKGELYNQYERLNRFADAVPVESFAVLEMIKLAKTAINDQSDLK
ALQKHYQTVLESAQKSEVMFKNNVSSLDTVLLAQKHVEVAKATLAVINELEKGQQPTSTQ
LDKLLSITTNASGMYDEMIVAIVRPTEELVRQLRK
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacacttttaactctttcgatttcaagctttctttttagtgcatcatccctc
gcttcagctcccaatacaaagttaaacttgatgccataccctcaatcagtagagttaaat
tcaggccaattagaaattactagtgatttcagtatttatatcgatggttataaatcagag
cgcattcagcaacttgccttacgtattattcaacgtgtagaagctcaaactggattacca
ctacttactccttttgcttcatctaaaaaggaagcaacactaattatcgatgtgagtaag
gcggccaaaaataaaattcaagataacgacattgacgagtcttacgaattaaccatcaat
aaaaaacaaatcattttagaatctgatcgtccatacggagcactccgtggtgcagagact
tttcttcaattaatcaacacatccaaagcgggttactttgttcctcaagtaaatattgaa
gatgaacctcgtttcccatggcgtggagcttcatttgactcctctcgtcactttgtcacc
gttgatacaataaaacgtcagattgatggttttgcttccgcaaaaatgaatgtttttcat
tggcacctatgggatgaccaagcaatccgaattcaaatcgaaagttaccctaagctgtgg
gagaaaactgccgatggtgatttctatacaaaagaagaaatcaaagacgttgttgaatac
gcccgcctacgcggtattcgagtaattcctgagatctcattacctggtcacgcttcagct
gttgctcatgcttaccctgaattaatgtctggagaaggtgaacaatcttacgatcaacaa
cgcgcttggggtgtttttgttcctctaatgaatcctattaaccctgaactctatgtcttc
ttcgacaaagtattcagtgaggtaactgagctgttcccagatgaatacattcacattggt
ggtgatgagccaaattaccaacaatggacagataataaagaaatccaagcattcatcgca
gaaaataatattgatggtaaccgtggtttacagtcatacctaaatgcacgcattgaaaaa
atgctaaacaagaaaggtaagaagatcatgggctgggatgagatttggcataaagatctg
ccaacatcgattgtcattcaaagctggcgtggacatgacagtattggtcgagcagcaaaa
gaaggttataccggattactttcaacggggttctatttagatcaaccgcaaccaaccagc
taccattatcgtaatgaccctatgccaaagggaccacaagtcgatgaccaactgcatagt
ggagaaacattcgaaacctacacttggcagaagccaagaggcaaaggtggtccacgtaaa
ggtaccctaactatcattaccgataagaatggtgatgctcgtgcctttactgattacaac
ggaaaatcacgagctaaagtcgatatcatggaatacaccaaaggtgagtcattccgtggt
cattttgataacttcatgtcttacaccgaatttaatctaatcttcaataacggcaacatt
aaaaaagaaagctaccagctagtcggaaatgttcgctggccaaccacaggtgaaatgacc
gcaagttcatcaatcaagaactcagtgattccagctcctaatggtggctatcctgttgct
ttaaataaagatgaagaaaaacttattcttggtggtgaagctgctatctgggcagaaaac
tacgacgacctaactgttgaaggtcgaatttggcctagaacttatgccgttgctgaacgt
ttatggtcagctgaagagcttaccgatgaagacagcatgtaccaacgcctacaggcaatg
gacagctgggcaacgatttctgttggcttacaacatcaaaccaatagctataagcagtat
ttacgtattgctaacggcggtgatgtgtctgcactgatgagttttgcaaactatgcagaa
cctgcccaatactatgctcgtaactgggcgaagtataattctaccgatccaaaaggagaa
ctatacaatcaatacgaaagattaaatcgctttgcagacgcagttccagtggagagtttt
gcagtattagaaatgataaaacttgcaaagacggcgatcaatgatcagagtgatttaaaa
gcactacaaaaacattaccaaactgtcttagagagtgcgcaaaaatcagaagtcatgttt
aaaaataatgtatcttctttagatactgtactgctagcccaaaaacatgttgaggtagca
aaagcaacgttagcagttattaatgagcttgaaaaaggccaacagccaacatcgacacaa
ctagataaactattatctattactacaaatgcatcaggaatgtacgatgaaatgattgtt
gctattgttcgcccaacagaagagttagttcgtcagttacgtaagtaa

DBGET integrated database retrieval system