KEGG   Aliivibrio fischeri ES114: VF_0284Help
Entry
VF_0284           CDS       T00236                                 

Gene name
folA
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00670  One carbon pool by folate
vfi00790  Folate biosynthesis
vfi01100  Metabolic pathways
Module
vfi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VF_0284 (folA)
   00670 One carbon pool by folate
    VF_0284 (folA)
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VF_0284 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 3277244
NCBI-ProteinID: YP_203667
UniProt: Q5E867
Position
I:288794..289261
Genome map
AA seq 155 aa AA seqDB search
MIAAMAKNRIIGIDNQMPWHLPADFAWFKKCTMGKPIVMGRKTYESIGRPLPGRLNIVLS
RDANLQIDGVTCVTSIEEAKQAAGDIEELMIIGGGSIYQACLSDADKLYLTFIDADINGD
TQFPDWGEGWNQTHSETYSKDEKNQYDMEFVVLER
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcaatggcaaagaatcgtattattggtattgataatcagatgccatggcat
ttacccgctgatttcgcttggtttaaaaaatgcactatgggtaaacctattgtcatgggg
cgtaagacttatgaatctattggtcgtccattaccgggccgattgaatatcgtattaagc
cgtgatgctaatttacaaatagacggagtgacttgtgttacttcgattgaagaagcgaaa
caagctgcaggtgatattgaagaacttatgattattggtggtggctcaatttaccaagcg
tgtctttctgatgcagataagttatacctgacttttattgatgctgacatcaatggcgat
actcaattccctgattggggtgagggttggaatcagactcattctgaaacgtattcgaaa
gatgaaaagaatcagtatgatatggagtttgtggttcttgagagataa

DBGET integrated database retrieval system