KEGG   Aliivibrio fischeri ES114: VF_0342Help
Entry
VF_0342           CDS       T00236                                 

Gene name
galU
Definition
(RefSeq) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00040  Pentose and glucuronate interconversions
vfi00052  Galactose metabolism
vfi00500  Starch and sucrose metabolism
vfi00520  Amino sugar and nucleotide sugar metabolism
vfi01100  Metabolic pathways
vfi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VF_0342 (galU)
   00052 Galactose metabolism
    VF_0342 (galU)
   00500 Starch and sucrose metabolism
    VF_0342 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VF_0342 (galU)
Enzymes [BR:vfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VF_0342 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 SAP30_Sin3_bdg
Motif
Other DBs
NCBI-GeneID: 3277909
NCBI-ProteinID: YP_203725
UniProt: Q5E809
Position
I:complement(371327..372196)
Genome map
AA seq 289 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAINAGMDGMCIVTGRGKH
SLMDHFDKNYELEHQISGTNKEELLEDVRELIDSAHFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVEEVPDNETHKYGVISGEMIKDD
LYRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALLKQAQSG
CVLAYKFKGKRFDCGSVEGYIEATNHCYENIYLKDKKSSELAKKVTGKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgtttatttcctgccgcaggctacggcacacgctttttaccagcaaca
aaatcaatgccaaaagaaatgatgcctgttgtaaacaagcctcttattgaatacggtgtt
gaagaagcaatcaatgctggtatggacggtatgtgtattgttactggtcgtggtaaacat
tctttaatggatcactttgataaaaactacgaattagagcaccaaatcagtggtacaaac
aaagaagaacttcttgaagatgttcgcgaactgattgattcagcccacttcacttatatt
cgtcaacgtgaaatgaaaggcttaggtcatgcaattttaacaggtcgtgaacttgtaggt
gatgaacctttcgcagttgtacttgctgatgacttatgtgtgaacgaagagcaaggcgta
ttggctcaaatggttgctttatacaagcaattccgttgttctatcgttgctgtagaagaa
gttccagacaacgaaacgcacaaatatggtgtgatttctggtgaaatgatcaaagatgat
ttataccgtgttgataacatggtagaaaaaccagagccaggaacagcaccaagcaaccta
gctattattggtcgttacatcctaactcctgatatttttgagttaatcgagcagacagaa
ccaggtaaaggcggtgaaattcaaatcaccgatgctctactaaaacaagcacaatcaggc
tgtgttttagcttataaatttaaaggtaagcgttttgactgtggcagcgttgaaggttat
atcgaagcaacgaaccactgttatgagaacatttatctaaaagataaaaaatcatcagaa
ttagcaaaaaaagtaacgggtaaaaaataa

DBGET integrated database retrieval system